DAP3 (NM_033657) Human Mass Spec Standard
CAT#: PH323182
DAP3 MS Standard C13 and N15-labeled recombinant protein (NP_387506)
View other "DAP3" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | DAP3 MS Standard C13 and N15-labeled recombinant protein (NP_387506) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223182 |
Predicted MW | 45.4 kDa |
Protein Sequence |
>RC223182 representing NM_033657
Red=Cloning site Green=Tags(s) MMLKGITRLISRIHKLDPGRFLHMGTQARQSIAAHLDNQVPVESPRAISRTNENDPAKHGDQHEGQHYNI SPQDLETVFPHGLPPRFVMQVKTFSEACLMVRKPALELLHYLKNTSFAYPAIRYLLYGEKGTGKTLSLCH VIHFCAKQDWLILHIPDAHLWVKNCRDLLQSSYNKQRFDQPLEASTWLKNFKTTNERFLNQIKVQEKYVW NKRESTEKGSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKS PIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKAYLPQELLGKEGFDALDPFIPILVSNYNP KEFESCIQYYLENNWLQHEKAPTEEGKKELLFLSNANPSLLERHCAYL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_387506 |
RefSeq Size | 1650 |
RefSeq ORF | 1194 |
Synonyms | bMRP-10; DAP-3; MRP-S29; MRPS29; S29mt |
Locus ID | 7818 |
Cytogenetics | 1q22 |
Summary | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that also participates in apoptotic pathways which are initiated by tumor necrosis factor-alpha, Fas ligand, and gamma interferon. This protein potentially binds ATP/GTP and might be a functional partner of the mitoribosomal protein S27. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. Pseudogenes corresponding to this gene are found on chromosomes 1q and 2q. [provided by RefSeq, Dec 2010] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403256 | DAP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417860 | DAP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403256 | Transient overexpression lysate of death associated protein 3 (DAP3), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
LY417860 | Transient overexpression lysate of death associated protein 3 (DAP3), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3080.00 |
|
TP323182 | Recombinant protein of human death associated protein 3 (DAP3), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2900.00 |