ASS1 (NM_000050) Human Mass Spec Standard
CAT#: PH323189
ASS1 MS Standard C13 and N15-labeled recombinant protein (NP_000041)
View other "ASS1" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | ASS1 MS Standard C13 and N15-labeled recombinant protein (NP_000041) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223189 |
| Predicted MW | 46.5 kDa |
| Protein Sequence |
>RC223189 protein sequence
Red=Cloning site Green=Tags(s) MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVE EFIWPAIQSSALYEDRYLLGTSLARPCIARKQVEIAQREGAKYVSHGATGKGNDQVRFELSCYSLAPQIK VIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKT QDPAKAPNTPDILEIEFKKGVPVKVTNVKDGTTHQTSLELFMYLNEVAGKHGVGRIDIVENRFIGMKSRG IYETPAGTILYHAHLDIEAFTMDREVRKIKQGLGLKFAELVYTGFWHSPECEFVRHCIAKSQERVEGKVQ VSVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKEYHRLQSKVTAK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000041 |
| RefSeq Size | 1863 |
| RefSeq ORF | 1236 |
| Synonyms | ASS; CTLN1 |
| Locus ID | 445 |
| Cytogenetics | 9q34.11 |
| Summary | The protein encoded by this gene catalyzes the penultimate step of the arginine biosynthetic pathway. There are approximately 10 to 14 copies of this gene including the pseudogenes scattered across the human genome, among which the one located on chromosome 9 appears to be the only functional gene for argininosuccinate synthetase. Mutations in the chromosome 9 copy of this gene cause citrullinemia. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Aug 2012] |
| Protein Families | Druggable Genome |
| Protein Pathways | Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403289 | ASS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424955 | ASS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403289 | Transient overexpression lysate of argininosuccinate synthetase 1 (ASS1), transcript variant 2 |
CNY 3080.00 |
|
| LY424955 | Transient overexpression lysate of argininosuccinate synthetase 1 (ASS1), transcript variant 1 |
CNY 3080.00 |
|
| PH301130 | ASS1 MS Standard C13 and N15-labeled recombinant protein (NP_446464) |
CNY 19520.00 |
|
| TP301130 | Recombinant protein of human argininosuccinate synthetase 1 (ASS1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP323189 | Recombinant protein of human argininosuccinate synthetase 1 (ASS1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP720522 | Recombinant protein of human argininosuccinate synthetase 1 (ASS1), transcript variant 1 |
CNY 1800.00 |
