RNF14 (NM_004290) Human Mass Spec Standard
CAT＃: PH323304
RNF14 MS Standard C13 and N15-labeled recombinant protein (NP_004281)
View other "RNF14" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Product images
CNY 1999.00
CNY 2700.00
CNY 4840.00
Specifications
| Product Data | |
| Description | RNF14 MS Standard C13 and N15-labeled recombinant protein (NP_004281) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223304 |
| Predicted MW | 53.8 kDa |
| Protein Sequence |
>RC223304 representing NM_004290
Red=Cloning site Green=Tags(s) MSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNECLQNSGFEYTICFL PPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGSVVLFAWMQFLKEETLAYLNI VSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNLIQEILDFDQAQQI KCFNSKLFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVK ELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPC KVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKNSKSCPCCGTPIEKLDGCNKM TCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEVED myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004281 |
| RefSeq Size | 4395 |
| RefSeq ORF | 1422 |
| Synonyms | ARA54; HFB30; HRIHFB2038; TRIAD2 |
| Locus ID | 9604 |
| Cytogenetics | 5q31.3 |
| Summary | The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Six alternatively spliced transcript variants encoding two distinct isoforms have been reported. [provided by RefSeq, Jan 2011] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405271 | RNF14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY405271 | Transient overexpression lysate of ring finger protein 14 (RNF14), transcript variant 4 |
CNY 4840.00 |
|
| PH323362 | RNF14 MS Standard C13 and N15-labeled recombinant protein (NP_899647) |
CNY 19520.00 |
|
| PH323420 | RNF14 MS Standard C13 and N15-labeled recombinant protein (NP_899648) |
CNY 14250.00 |
|
| PH323491 | RNF14 MS Standard C13 and N15-labeled recombinant protein (NP_899646) |
CNY 14250.00 |
|
| TP323304 | Purified recombinant protein of Homo sapiens ring finger protein 14 (RNF14), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP323362 | Recombinant protein of human ring finger protein 14 (RNF14), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP323420 | Purified recombinant protein of Homo sapiens ring finger protein 14 (RNF14), transcript variant 5, 20 µg |
CNY 2900.00 |
|
| TP323491 | Purified recombinant protein of Homo sapiens ring finger protein 14 (RNF14), transcript variant 3, 20 µg |
CNY 2900.00 |
