C11orf17 (AKIP1) (NM_020642) Human Mass Spec Standard
CAT#: PH323315
C11orf17 MS Standard C13 and N15-labeled recombinant protein (NP_065693)
View other "C11orf17" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | C11orf17 MS Standard C13 and N15-labeled recombinant protein (NP_065693) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223315 |
| Predicted MW | 22.9 kDa |
| Protein Sequence |
>RC223315 representing NM_020642
Red=Cloning site Green=Tags(s) MDNCLAAAALNGVDRRSLQRSARLALEVLERAKRRAVDWHALERPKGCMGVLAREAPHLEKQPAAGPQRV LPGEREERPPTLSASFRTMAEFMDYTSSQCGKYYSSVPEEGGATHVYRYHRGESKLHMCLDIGNGQRKDR KKTSLGPGGSYQISEHAPEASQPAENISKDLYIEVYPGTYSVTVGSNDLTKKTHVVAVDSGQSVDLVFPV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_065693 |
| RefSeq Size | 1332 |
| RefSeq ORF | 630 |
| Synonyms | BCA3; C11orf17 |
| Locus ID | 56672 |
| Cytogenetics | 11p15.4 |
| Summary | This gene encodes a nuclear protein that interacts with protein kinase A catalytic subunit, and regulates the effect of the cAMP-dependent protein kinase signaling pathway on the NF-kappa-B activation cascade. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Oct 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402797 | AKIP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405392 | AKIP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402797 | Transient overexpression lysate of chromosome 11 open reading frame 17 (C11orf17), transcript variant 1 |
CNY 3080.00 |
|
| LY405392 | Transient overexpression lysate of chromosome 11 open reading frame 17 (C11orf17), transcript variant 1 |
CNY 3080.00 |
|
| TP323315 | Recombinant protein of human chromosome 11 open reading frame 17 (C11orf17), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP760335 | Purified recombinant protein of Homo sapiens A kinase (PRKA) interacting protein 1 (AKIP1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
其它C11orf17产品
