UPB1 (NM_016327) Human Mass Spec Standard
CAT#: PH323365
UPB1 MS Standard C13 and N15-labeled recombinant protein (NP_057411)
View other "UPB1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | UPB1 MS Standard C13 and N15-labeled recombinant protein (NP_057411) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223365 |
| Predicted MW | 43.2 kDa |
| Protein Sequence |
>RC223365 protein sequence
Red=Cloning site Green=Tags(s) MAGAEWKSLEECLEKHLPLPDLQEVKRVLYGKELRKLDLPREAFEAASREDFELQGYAFEAAEEQLRRPR IVHVGLVQNRIPLPANAPVAEQVSALHRRIKAIVEVAAMCGVNIICFQEAWTMPFAFCTREKLPWTEFAE SAEDGPTTRFCQKLAKNHDMVVVSPILERDSEHGDVLWNTAVVISNSGAVLGKTRKNHIPRVGDFNESTY YMEGNLGHPVFQTQFGRIAVNICYGRHHPLNWLMYSINGAEIIFNPSATIGALSESLWPIEARNAAIANH CFTCAINRVGTEHFPNEFTSGDGKKAHQDFGYFYGSSYVAAPDSSRTPGLSRSRDGLLVAKLDLNLCQQV NDVWNFKMTGRYEMYARELAEAVKSNYSPTIVKE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057411 |
| RefSeq Size | 2167 |
| RefSeq ORF | 1152 |
| Synonyms | BUP1 |
| Locus ID | 51733 |
| Cytogenetics | 22q11.23 |
| Summary | This gene encodes a protein that belongs to the CN hydrolase family. Beta-ureidopropionase catalyzes the last step in the pyrimidine degradation pathway. The pyrimidine bases uracil and thymine are degraded via the consecutive action of dihydropyrimidine dehydrogenase (DHPDH), dihydropyrimidinase (DHP) and beta-ureidopropionase (UP) to beta-alanine and beta-aminoisobutyric acid, respectively. UP deficiencies are associated with N-carbamyl-beta-amino aciduria and may lead to abnormalities in neurological activity. [provided by RefSeq, Jul 2008] |
| Protein Pathways | beta-Alanine metabolism, Drug metabolism - other enzymes, Metabolic pathways, Pantothenate and CoA biosynthesis, Pyrimidine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414060 | UPB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414060 | Transient overexpression lysate of ureidopropionase, beta (UPB1) |
CNY 3080.00 |
|
| TP323365 | Recombinant protein of human ureidopropionase, beta (UPB1), 20 µg |
CNY 2900.00 |
|
| TP720186 | Recombinant protein of human ureidopropionase, beta (UPB1) |
CNY 1800.00 |
|
| TP760830 | Purified recombinant protein of Human ureidopropionase, beta (UPB1), full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
