GAD65 (GAD2) (NM_000818) Human Mass Spec Standard
CAT#: PH323464
GAD2 MS Standard C13 and N15-labeled recombinant protein (NP_000809)
View other "GAD65" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | GAD2 MS Standard C13 and N15-labeled recombinant protein (NP_000809) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223464 |
Predicted MW | 65.4 kDa |
Protein Sequence |
>RC223464 protein sequence
Red=Cloning site Green=Tags(s) MASPGSGFWSFGSEDGSGDSENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGGSQPPRAAARK AACACDQKPCSCSKVDVNYAFLHATDLLPACDGERPTLAFLQDVMNILLQYVVKSFDRSTKVIDFHYPNE LLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGHPRYFNQLSTGLDMVGLAADWLTSTANTNMFTYEIA PVFVLLEYVTLKKMREIIGWPGGSGDGIFSPGGAISNMYAMMIARFKMFPEVKEKGMAALPRLIAFTSEH SHFSLKKGAAALGIGTDSVILIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAV ADICKKYKIWMHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQNCNQ MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEYLYNIIKNREG YEMVFDGKPQHTNVCFWYIPPSLRTLEDNEERMSRLSKVAPVIKARMMEYGTTMVSYQPLGDKVNFFRMV ISNPAATHQDIDFLIEEIERLGQDL SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000809 |
RefSeq Size | 2824 |
RefSeq ORF | 1755 |
Synonyms | GAD65 |
Locus ID | 2572 |
Cytogenetics | 10p12.1 |
Summary | This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantibody and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Oct 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Alanine, aspartate and glutamate metabolism, beta-Alanine metabolism, Butanoate metabolism, Metabolic pathways, Taurine and hypotaurine metabolism, Type I diabetes mellitus |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424506 | GAD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC427399 | GAD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424506 | Transient overexpression lysate of glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa) (GAD2), transcript variant 1 |
CNY 4840.00 |
|
LY427399 | Transient overexpression lysate of glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa) (GAD2), transcript variant 2 |
CNY 3080.00 |
|
PH325984 | GAD2 MS Standard C13 and N15-labeled recombinant protein (NP_001127838) |
CNY 19520.00 |
|
TP323464 | Recombinant protein of human glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa) (GAD2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP325984 | Recombinant protein of human glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa) (GAD2), transcript variant 2, 20 µg |
CNY 2900.00 |