ketohexokinase (KHK) (NM_006488) Human Mass Spec Standard
CAT#: PH323488
KHK MS Standard C13 and N15-labeled recombinant protein (NP_006479)
View other "ketohexokinase" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | KHK MS Standard C13 and N15-labeled recombinant protein (NP_006479) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223488 |
| Predicted MW | 32.3 kDa |
| Protein Sequence |
>RC223488 representing NM_006488
Red=Cloning site Green=Tags(s) MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVAD FLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDVSATDFEKVDLTQFKWIHIEG RNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRG LYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRF GCQVAGKKCGLQGFDGIV SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006479 |
| RefSeq Size | 1899 |
| RefSeq ORF | 894 |
| Locus ID | 3795 |
| Cytogenetics | 2p23.3 |
| Summary | This gene encodes ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The product of this gene is the first enzyme with a specialized pathway that catabolizes dietary fructose. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Fructose and mannose metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400082 | KHK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416608 | KHK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400082 | Transient overexpression lysate of ketohexokinase (fructokinase) (KHK), transcript variant a |
CNY 3080.00 |
|
| LY416608 | Transient overexpression lysate of ketohexokinase (fructokinase) (KHK), transcript variant b |
CNY 3080.00 |
|
| PH302424 | KHK MS Standard C13 and N15-labeled recombinant protein (NP_000212) |
CNY 19520.00 |
|
| TP302424 | Recombinant protein of human ketohexokinase (fructokinase) (KHK), transcript variant a, 20 µg |
CNY 2900.00 |
|
| TP323488 | Recombinant protein of human ketohexokinase (fructokinase) (KHK), transcript variant b, 20 µg |
CNY 2900.00 |
|
| TP721095 | Purified recombinant protein of Human ketohexokinase (fructokinase) (KHK), transcript variant a |
CNY 1800.00 |
其它ketohexokinase产品
