CTIP1 (BCL11A) (NM_138559) Human Mass Spec Standard
CAT#: PH323575
BCL11A MS Standard C13 and N15-labeled recombinant protein (NP_612569)
View other "CTIP1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | BCL11A MS Standard C13 and N15-labeled recombinant protein (NP_612569) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223575 |
| Predicted MW | 26.7 kDa |
| Protein Sequence |
>RC223575 representing NM_138559
Red=Cloning site Green=Tags(s) MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQ CNGSLCLEKAVDKPPSPSPIEMKKASNPVEVGIQVTPEDDDCLSTSSRGICPKQEHIADKLLHWRGLSSP RSAHGALIPTPGMSAEYAPQGICKDEPSSYTCTTCKQPFTSAWFLLQHAQNTHGLRIYLESEHGSPLTPR VLHTPPFGVVPRELKMCGSFRMEAREPLSSEKI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_612569 |
| RefSeq Size | 2358 |
| RefSeq ORF | 729 |
| Synonyms | BCL11A-L; BCL11a-M; BCL11A-S; BCL11A-XL; CTIP1; DILOS; EVI9; HBFQTL5; ZNF856 |
| Locus ID | 53335 |
| Cytogenetics | 2p16.1 |
| Summary | This gene encodes a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, through its interaction with BCL6. During hematopoietic cell differentiation, this gene is down-regulated. It is possibly involved in lymphoma pathogenesis since translocations associated with B-cell malignancies also deregulates its expression. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408578 | BCL11A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC411466 | BCL11A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY408578 | Transient overexpression lysate of B-cell CLL/lymphoma 11A (zinc finger protein) (BCL11A), transcript variant 3 |
CNY 3080.00 |
|
| LY411466 | Transient overexpression lysate of B-cell CLL/lymphoma 11A (zinc finger protein) (BCL11A), transcript variant 1 |
CNY 4840.00 |
|
| TP323575 | Recombinant protein of human B-cell CLL/lymphoma 11A (zinc finger protein) (BCL11A), transcript variant 3, 20 µg |
CNY 2900.00 |
