Caspase 3 (CASP3) (NM_004346) Human Mass Spec Standard
CAT#: PH323662
CASP3 MS Standard C13 and N15-labeled recombinant protein (NP_004337)
View other "Caspase 3" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CASP3 MS Standard C13 and N15-labeled recombinant protein (NP_004337) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223662 |
Predicted MW | 31.6 kDa |
Protein Sequence |
>RC223662 protein sequence
Red=Cloning site Green=Tags(s) MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVD AANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKIT NFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSK DGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004337 |
RefSeq Size | 2689 |
RefSeq ORF | 831 |
Synonyms | CPP32; CPP32B; SCA-1 |
Locus ID | 836 |
Cytogenetics | 4q35.1 |
Summary | The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulatory element binding proteins as well as caspases 6, 7, and 9. This protein itself is processed by caspases 8, 9, and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. [provided by RefSeq, Aug 2017] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Protease |
Protein Pathways | Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Colorectal cancer, Epithelial cell signaling in Helicobacter pylori infection, Huntington's disease, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, p53 signaling pathway, Parkinson's disease, Pathways in cancer, Viral myocarditis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403215 | CASP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418048 | CASP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418048 | Transient overexpression lysate of caspase 3, apoptosis-related cysteine peptidase (CASP3), transcript variant alpha |
CNY 3080.00 |
|
PH304444 | CASP3 MS Standard C13 and N15-labeled recombinant protein (NP_116786) |
CNY 19520.00 |
|
TP304444 | Recombinant protein of human caspase 3, apoptosis-related cysteine peptidase (CASP3), transcript variant beta, 20 µg |
CNY 2900.00 |
|
TP323662 | Recombinant protein of human caspase 3, apoptosis-related cysteine peptidase (CASP3), transcript variant alpha, 20 µg |
CNY 2900.00 |
其它Caspase 3产品