REG3G (NM_001008387) Human Mass Spec Standard
CAT＃: PH323733
REG3G MS Standard C13 and N15-labeled recombinant protein (NP_001008388)
View other "REG3G" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | REG3G MS Standard C13 and N15-labeled recombinant protein (NP_001008388) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223733 |
| Predicted MW | 19.3 kDa |
| Protein Sequence |
>RC223733 protein sequence
Red=Cloning site Green=Tags(s) MLPPMALPSVSWMLLSCLILLCQVQGEETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQK RPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTI LNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001008388 |
| RefSeq Size | 955 |
| RefSeq ORF | 525 |
| Synonyms | LPPM429; PAP-1B; PAP1B; PAP IB; PAPIB; REG-III; REG III; UNQ429 |
| Locus ID | 130120 |
| Cytogenetics | 2p12 |
| Summary | This gene encodes a member of the regenerating islet-derived genes (REG)3 protein family. These proteins are secreted, C-type lectins with a carbohydrate recognition domain and N-terminal signal peptide. The protein encoded by this gene is an antimicrobial lectin with activity against Gram-positive bacteria. Alternative splicing results in multiple transcript variants encoding multiple isoforms. [provided by RefSeq, Nov 2014] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404935 | REG3G HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423414 | REG3G HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404935 | Transient overexpression lysate of regenerating islet-derived 3 gamma (REG3G), transcript variant 2 |
CNY 3080.00 |
|
| LY423414 | Transient overexpression lysate of regenerating islet-derived 3 gamma (REG3G), transcript variant 1 |
CNY 3080.00 |
|
| PH323686 | REG3G MS Standard C13 and N15-labeled recombinant protein (NP_940850) |
CNY 19520.00 |
|
| TP323686 | Recombinant protein of human regenerating islet-derived 3 gamma (REG3G), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP323733 | Recombinant protein of human regenerating islet-derived 3 gamma (REG3G), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP721105 | Purified recombinant protein of Human regenerating islet-derived 3 gamma (REG3G), transcript variant 2 |
CNY 1800.00 |
