LXR alpha (NR1H3) (NM_005693) Human Mass Spec Standard
CAT#: PH323767
NR1H3 MS Standard C13 and N15-labeled recombinant protein (NP_005684)
View other "LXR alpha" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 4840.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | NR1H3 MS Standard C13 and N15-labeled recombinant protein (NP_005684) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223767 |
Predicted MW | 50.2 kDa |
Protein Sequence |
>RC223767 representing NM_005693
Red=Cloning site Green=Tags(s) MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEAAEPTALLTRA EPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGAHYICHSGGHC PMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQEEEQAHATSLPPRASSPPQILPQLSPEQ LGMIEKLVAAQQQCNRRSFSDRLRVTPWPMAPDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQ LSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQ LNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV HSEQVFALRLQDKKLPPLLSEIWDVHE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005684 |
RefSeq Size | 1528 |
RefSeq ORF | 1341 |
Synonyms | LXR-a; LXRA; RLD-1 |
Locus ID | 10062 |
Cytogenetics | 11p11.2 |
Summary | The protein encoded by this gene belongs to the NR1 subfamily of the nuclear receptor superfamily. The NR1 family members are key regulators of macrophage function, controlling transcriptional programs involved in lipid homeostasis and inflammation. This protein is highly expressed in visceral organs, including liver, kidney and intestine. It forms a heterodimer with retinoid X receptor (RXR), and regulates expression of target genes containing retinoid response elements. Studies in mice lacking this gene suggest that it may play an important role in the regulation of cholesterol homeostasis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Protein Pathways | PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401738 | NR1H3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY401738 | Transient overexpression lysate of nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1 |
CNY 4840.00 |
|
TP323767 | Recombinant protein of human nuclear receptor subfamily 1, group H, member 3 (NR1H3), transcript variant 1, 20 µg |
CNY 2900.00 |
其它LXR alpha产品