MMACHC (NM_015506) Human Mass Spec Standard
CAT#: PH323846
MMACHC MS Standard C13 and N15-labeled recombinant protein (NP_056321)
View other "MMACHC" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | MMACHC MS Standard C13 and N15-labeled recombinant protein (NP_056321) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223846 |
| Predicted MW | 31.5 kDa |
| Protein Sequence |
>RC223846 representing NM_015506
Red=Cloning site Green=Tags(s) MEPKVAELKQKIEDTLCPFGFEVYPFQVAWYNELLPPAFHLPLPGPTLAFLVLSTPAMFDRALKPFLQSC HLRMLTDPVDQCVAYHLGRVRESLPELQIEIIADYEVHPNRRPKILAQTAAHVAGAAYYYQRQDVEADPW GNQRISGVCIHPRFGGWFAIRGVVLLPGIEVPDLPPRKPHDCVPTRADRIALLEGFNFHWRDWTYRDAVT PQERYSEEQKAYFSTPPAQRLALLGLAQPSEKPSSPSPDLPFTTPAPKKPGNPSRARSWLSPRVSPPASP GP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_056321 |
| RefSeq Size | 2247 |
| RefSeq ORF | 846 |
| Synonyms | cblC |
| Locus ID | 25974 |
| Cytogenetics | 1p34.1 |
| Summary | The exact function of the protein encoded by this gene is not known, however, its C-terminal region shows similarity to TonB, a bacterial protein involved in energy transduction for cobalamin (vitamin B12) uptake. Hence, it is postulated that this protein may have a role in the binding and intracellular trafficking of cobalamin. Mutations in this gene are associated with methylmalonic aciduria and homocystinuria type cblC. [provided by RefSeq, Oct 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402444 | MMACHC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402444 | Transient overexpression lysate of methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria (MMACHC) |
CNY 3080.00 |
|
| TP323846 | Recombinant protein of human methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria (MMACHC), 20 µg |
CNY 2900.00 |
