TIPRL (NM_152902) Human Mass Spec Standard
CAT#: PH323912
TIPRL MS Standard C13 and N15-labeled recombinant protein (NP_690866)
View other "TIPRL" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | TIPRL MS Standard C13 and N15-labeled recombinant protein (NP_690866) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223912 |
| Predicted MW | 31.3 kDa |
| Protein Sequence |
>RC223912 representing NM_152902
Red=Cloning site Green=Tags(s) MMIHGFQSSHRDFCFGPWKLTASKTHIMKSADVEKLADELHMPSLPEMMFGDNVLRIQHGSGFGIEFNAT DALRCVNNYQGMLKVACAEEWQESRTEGEHSKEVIKPYDWTYTTDYKGTLLGESLKLKVVPTTDHIDTEK LKAREQIKFFEEVLLFEDELHDHGVSSLSVKIRVMPSSFFLLLRFFLRIDGVLIRMNDTRLYHEADKTYM LREYTSRESKISSLMHVPPSLFTEPNEISQYLPIKEAVCEKLIFPERIDPNPADSQKSTQVE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_690866 |
| RefSeq Size | 3032 |
| RefSeq ORF | 816 |
| Synonyms | TIP; TIP41; TIPRL1 |
| Locus ID | 261726 |
| Cytogenetics | 1q24.2 |
| Summary | TIPRL is an inhibitory regulator of protein phosphatase-2A (PP2A) (see PPP2CA; MIM 176915), PP4 (see PPP4C; MIM 602035), and PP6 (see PPP6C; MIM 612725) (McConnell et al., 2007 [PubMed 17384681]).[supplied by OMIM, Nov 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403496 | TIPRL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422192 | TIPRL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403496 | Transient overexpression lysate of TIP41, TOR signaling pathway regulator-like (S. cerevisiae) (TIPRL), transcript variant 1 |
CNY 3080.00 |
|
| LY422192 | Transient overexpression lysate of TIP41, TOR signaling pathway regulator-like (S. cerevisiae) (TIPRL), transcript variant 2 |
CNY 3080.00 |
|
| TP323912 | Recombinant protein of human TIP41, TOR signaling pathway regulator-like (S. cerevisiae) (TIPRL), transcript variant 1, 20 µg |
CNY 2900.00 |
