Aspartate beta hydroxylase (ASPH) (NM_032468) Human Mass Spec Standard
CAT#: PH323930
ASPH MS Standard C13 and N15-labeled recombinant protein (NP_115857)
View other "Aspartate beta hydroxylase" proteins (15)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ASPH MS Standard C13 and N15-labeled recombinant protein (NP_115857) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223930 |
Predicted MW | 33.6 kDa |
Protein Sequence |
>RC223930 representing NM_032468
Red=Cloning site Green=Tags(s) MAEDKETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVDYEEVLAKAKDFRYNLSEVLQ GKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSL LHEMVHAEHVEGEDLQQEDGPTGEPQQEDDEFLMATDVDDRFETLEPEVSHEETEHSYHVEETVSQDCNQ DMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEITEVTAPPEDNPVEDSQVI VEEVSIFPVEEQQEVPPDT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_115857 |
RefSeq Size | 2773 |
RefSeq ORF | 897 |
Synonyms | AAH; BAH; CASQ2BP1; FDLAB; HAAH; JCTN; junctin |
Locus ID | 444 |
Cytogenetics | 8q12.3 |
Summary | This gene is thought to play an important role in calcium homeostasis. The gene is expressed from two promoters and undergoes extensive alternative splicing. The encoded set of proteins share varying amounts of overlap near their N-termini but have substantial variations in their C-terminal domains resulting in distinct functional properties. The longest isoforms (a and f) include a C-terminal Aspartyl/Asparaginyl beta-hydroxylase domain that hydroxylates aspartic acid or asparagine residues in the epidermal growth factor (EGF)-like domains of some proteins, including protein C, coagulation factors VII, IX, and X, and the complement factors C1R and C1S. Other isoforms differ primarily in the C-terminal sequence and lack the hydroxylase domain, and some have been localized to the endoplasmic and sarcoplasmic reticulum. Some of these isoforms are found in complexes with calsequestrin, triadin, and the ryanodine receptor, and have been shown to regulate calcium release from the sarcoplasmic reticulum. Some isoforms have been implicated in metastasis. [provided by RefSeq, Sep 2009] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410099 | ASPH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC410101 | ASPH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418063 | ASPH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC431238 | ASPH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410099 | Transient overexpression lysate of aspartate beta-hydroxylase (ASPH), transcript variant 3 |
CNY 3080.00 |
|
LY410101 | Transient overexpression lysate of aspartate beta-hydroxylase (ASPH), transcript variant 2 |
CNY 3080.00 |
|
LY418063 | Transient overexpression lysate of aspartate beta-hydroxylase (ASPH), transcript variant 1 |
CNY 4840.00 |
|
LY431238 | Transient overexpression lysate of aspartate beta-hydroxylase (ASPH), transcript variant 8 |
CNY 3080.00 |
|
PH311817 | ASPH MS Standard C13 and N15-labeled recombinant protein (NP_115855) |
CNY 19520.00 |
|
PH316796 | ASPH MS Standard C13 and N15-labeled recombinant protein (NP_004309) |
CNY 19520.00 |
|
TP311817 | Recombinant protein of human aspartate beta-hydroxylase (ASPH), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP316796 | Recombinant protein of human aspartate beta-hydroxylase (ASPH), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP323930 | Recombinant protein of human aspartate beta-hydroxylase (ASPH), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP328203 | Purified recombinant protein of Homo sapiens aspartate beta-hydroxylase (ASPH), transcript variant 11, 20 µg |
CNY 2900.00 |
|
TP328230 | Purified recombinant protein of Homo sapiens aspartate beta-hydroxylase (ASPH), transcript variant 10, 20 µg |
CNY 2900.00 |
其它Aspartate beta hydroxylase产品