CD252 (TNFSF4) (NM_003326) Human Mass Spec Standard
CAT#: PH324021
TNFSF4 MS Standard C13 and N15-labeled recombinant protein (NP_003317)
View other "CD252" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 3340.00
Specifications
| Product Data | |
| Description | TNFSF4 MS Standard C13 and N15-labeled recombinant protein (NP_003317) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC224021 |
| Predicted MW | 20.9 kDa |
| Protein Sequence |
>RC224021 representing NM_003326
Red=Cloning site Green=Tags(s) MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYK KEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMV ASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003317 |
| RefSeq Size | 3510 |
| RefSeq ORF | 549 |
| Synonyms | CD134L; CD252; GP34; OX-40L; OX4OL; TNLG2B; TXGP1 |
| Locus ID | 7292 |
| Cytogenetics | 1q25.1 |
| Summary | This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401143 | TNFSF4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401143 | Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 4 (TNFSF4) |
CNY 3080.00 |
|
| TP324021 | Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 4 (TNFSF4), 20 µg |
CNY 2900.00 |
|
| TP700285 | Purified recombinant protein of human tumor necrosis factor (ligand) superfamily, member 4 (TNFSF4), with C-terminal Fc tag, expressed in human cells, 20 µg |
CNY 6650.00 |
|
| TP723944 | Human OX40L Protein, mFc-His tag |
CNY 5249.00 |
