RGS3 (NM_130795) Human Mass Spec Standard
CAT#: PH324058
RGS3 MS Standard C13 and N15-labeled recombinant protein (NP_570613)
View other "RGS3" proteins (16)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RGS3 MS Standard C13 and N15-labeled recombinant protein (NP_570613) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC224058 |
| Predicted MW | 100.8 kDa |
| Protein Sequence |
>RC224058 representing NM_130795
Red=Cloning site Green=Tags(s) MNRFNGLCKVCSERRYRQITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEH WKCVELAHEIRSCPSEIILLVWRMVPQVKPGPDGGVLRRASCKSTHDLQSPPNKREKNCTHGVQARPEQR HSCHLVCDSSDGLLLGGWERYTEVAKRGGQHTLPALSRATAPTDPNYIILAPLNPGSQLLRPVYQEDTIP EESGSPSKGKSYTGLGKKSRLMKTVQTMKGHGNYQNCPVVRPHATHSSYGTYVTLAPKVLVFPVFVQPLD LCNPARTLLLSEELLLYEGRNKAAEVTLFAYSDLLLFTKEDEPGRCDVLRNPLYLQSVKLQEGSSEDLKF CVLYLAEKAECLFTLEAHSQEQKKRVCWCLSENIAKQQQLAASPPDSKMFETEADEKREMALEEGKGPGA EDSPPSKEPSPGQELPPGQDLPPNKDSPSGQEPAPSQEPLSSKDSATSEGSPPGPDAPPSKDVPPCQEPP PAQDLSPCQDLPAGQEPLPHQDPLLTKDLPAIQESPTRDLPPCQDLPPSQVSLPAKALTEDTMSSGDLLA ATGDPPAAPRPAFVIPEVRLDSTYSQKAGAEQGCSGDEEDAEEAEEVEEGEEGEEDEDEDTSDDNYGERS EAKRSSMIETGQGAEGGLSLRVQNSLRRRTHSEGSLLQEPRGPCFASDTTLHCSDGEGAASTWGMPSPST LKKELGRNGGSMHHLSLFFTGHRKMSGADTVGDDDEASRKRKSKNLAKDMKNKLGIFRRRNESPGAPPAG KADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASK AKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQ KKMSPPL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_570613 |
| RefSeq Size | 3741 |
| RefSeq ORF | 2751 |
| Synonyms | C2PA; RGP3 |
| Locus ID | 5998 |
| Cytogenetics | 9q32 |
| Summary | This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTPase-activating protein that inhibits G-protein-mediated signal transduction. Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding different isoforms. Long isoforms are largely cytosolic and plasma membrane-associated with a function in Wnt signaling and in the epithelial mesenchymal transition, while shorter N-terminally-truncated isoforms can be nuclear. [provided by RefSeq, Jan 2013] |
| Protein Families | Druggable Genome |
| Protein Pathways | Axon guidance |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402835 | RGS3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC403390 | RGS3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408751 | RGS3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408949 | RGS3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC413532 | RGS3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY402835 | Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 2 |
CNY 4840.00 |
|
| LY403390 | Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 5 |
CNY 3080.00 |
|
| LY408751 | Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 4 |
CNY 3080.00 |
|
| LY408949 | Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 1 |
CNY 3080.00 |
|
| LY413532 | Transient overexpression lysate of regulator of G-protein signaling 3 (RGS3), transcript variant 3 |
CNY 4840.00 |
|
| PH306471 | RGS3 MS Standard C13 and N15-labeled recombinant protein (NP_602299) |
CNY 19520.00 |
|
| PH324111 | RGS3 MS Standard C13 and N15-labeled recombinant protein (NP_066929) |
CNY 19520.00 |
|
| TP306471 | Recombinant protein of human regulator of G-protein signaling 3 (RGS3), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP324058 | Recombinant protein of human regulator of G-protein signaling 3 (RGS3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP324111 | Recombinant protein of human regulator of G-protein signaling 3 (RGS3), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP760493 | Purified recombinant protein of Human regulator of G-protein signaling 3 (RGS3), transcript variant 5, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
