Oxytocin neurophysin 1 (OXT) (NM_000915) Human Mass Spec Standard
CAT#: PH324226
OXT MS Standard C13 and N15-labeled recombinant protein (NP_000906)
View other "Oxytocin neurophysin 1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | OXT MS Standard C13 and N15-labeled recombinant protein (NP_000906) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224226 |
Predicted MW | 12.72 kDa |
Protein Sequence |
>RC224226 representing NM_000915
Red=Cloning site Green=Tags(s) MAGPSLACCLLGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTA EALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000906 |
RefSeq Size | 512 |
RefSeq ORF | 375 |
Synonyms | OT; OT-NPI; OXT-NPI |
Locus ID | 5020 |
Cytogenetics | 20p13 |
Summary | This gene encodes a precursor protein that is processed to produce oxytocin and neurophysin I. Oxytocin is a posterior pituitary hormone which is synthesized as an inactive precursor in the hypothalamus along with its carrier protein neurophysin I. Together with neurophysin, it is packaged into neurosecretory vesicles and transported axonally to the nerve endings in the neurohypophysis, where it is either stored or secreted into the bloodstream. The precursor seems to be activated while it is being transported along the axon to the posterior pituitary. This hormone contracts smooth muscle during parturition and lactation. It is also involved in cognition, tolerance, adaptation and complex sexual and maternal behaviour, as well as in the regulation of water excretion and cardiovascular functions. [provided by RefSeq, Dec 2013] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
其它Oxytocin neurophysin 1产品