CKMT2 (NM_001099735) Human Mass Spec Standard
CAT#: PH324501
CKMT2 MS Standard C13 and N15-labeled recombinant protein (NP_001093205)
View other "CKMT2" proteins (12)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CKMT2 MS Standard C13 and N15-labeled recombinant protein (NP_001093205) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224501 |
Predicted MW | 47.5 kDa |
Protein Sequence |
>RC224501 protein sequence
Red=Cloning site Green=Tags(s) MASIFSKLLTGRNASLLFATMGTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKHNNCMAECLTP AIYAKLRNKVTPNGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMK HTTDLDASKITQGQFDEHYVLSSRVRTGRSIRGLSLPPACTRAERREVENVAITALEGLKGDLAGRYYKL SEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNM KRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLR LQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGKK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001093205 |
RefSeq Size | 1486 |
RefSeq ORF | 1257 |
Synonyms | SMTCK |
Locus ID | 1160 |
Cytogenetics | 5q14.1 |
Summary | Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Arginine and proline metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400691 | CKMT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420508 | CKMT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC420509 | CKMT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC426083 | CKMT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400691 | Transient overexpression lysate of creatine kinase, mitochondrial 2 (sarcomeric) (CKMT2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
LY420508 | Transient overexpression lysate of creatine kinase, mitochondrial 2 (sarcomeric) (CKMT2), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 4840.00 |
|
LY420509 | Transient overexpression lysate of creatine kinase, mitochondrial 2 (sarcomeric) (CKMT2), nuclear gene encoding mitochondrial protein, transcript variant 3 |
CNY 4840.00 |
|
PH306607 | CKMT2 MS Standard C13 and N15-labeled recombinant protein (NP_001816) |
CNY 19520.00 |
|
PH316991 | CKMT2 MS Standard C13 and N15-labeled recombinant protein (NP_001093206) |
CNY 19520.00 |
|
TP306607 | Recombinant protein of human creatine kinase, mitochondrial 2 (sarcomeric) (CKMT2), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP316991 | Recombinant protein of human creatine kinase, mitochondrial 2 (sarcomeric) (CKMT2), nuclear gene encoding mitochondrial protein, transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP324501 | Recombinant protein of human creatine kinase, mitochondrial 2 (sarcomeric) (CKMT2), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg |
CNY 2900.00 |