WNT8A (NM_058244) Human Mass Spec Standard
CAT#: PH324816
WNT8A MS Standard C13 and N15-labeled recombinant protein (NP_490645)
View other "WNT8A" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | WNT8A MS Standard C13 and N15-labeled recombinant protein (NP_490645) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224816 |
Predicted MW | 38.7 kDa |
Protein Sequence |
>RC224816 representing NM_058244
Red=Cloning site Green=Tags(s) MGNLFMLWAALGICCAAFSASAWSVNNFLITGPKAYLTYTTSVALGAQSGIEECKFQFAWERWNCPENAL QLSTHNRLRSATRETSFIHAISSAGVMYIITKNCSMGDFENCGCDGSNNGKTGGHGWIWGGCSDNVEFGE RISKLFVDSLEKGKDARALMNLHNNRAGRLAVRATMKRTCKCHGISGSCSIQTCWLQLAEFREMGDYLKA KYDQALKIEMDKRQLRAGNSAEGHWVPAEAFLPSAEAELIFLEESPDYCTCNSSLGIYGTEGRECLQNSH NTSRWERRSCGRLCTECGLQVEERKTEVISSCNCKFQWCCTVKCDQCRHVVSKYYCARSPGSAQSLGKGS A myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_490645 |
RefSeq Size | 1899 |
RefSeq ORF | 1053 |
Synonyms | WNT8D |
Locus ID | 7478 |
Cytogenetics | 5q31.2 |
Summary | The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family, and may be implicated in development of early embryos as well as germ cell tumors. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2014] |
Protein Families | Cancer stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Secreted Protein, Stem cell relevant signaling - Wnt Signaling pathway |
Protein Pathways | Basal cell carcinoma, Hedgehog signaling pathway, Melanogenesis, Pathways in cancer, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403304 | WNT8A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403304 | Transient overexpression lysate of wingless-type MMTV integration site family, member 8A (WNT8A) |
CNY 3080.00 |
|
TP324816 | Recombinant protein of human wingless-type MMTV integration site family, member 8A (WNT8A), 20 µg |
CNY 2900.00 |