Myosin (MYL6) (NM_079423) Human Mass Spec Standard
CAT#: PH324925
MYL6 MS Standard C13 and N15-labeled recombinant protein (NP_524147)
View other "Myosin" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | MYL6 MS Standard C13 and N15-labeled recombinant protein (NP_524147) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC224925 |
| Predicted MW | 17 kDa |
| Protein Sequence |
>RC224925 protein sequence
Red=Cloning site Green=Tags(s) MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHF LPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCIN YEELVRMVLNG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_524147 |
| RefSeq Size | 782 |
| RefSeq ORF | 453 |
| Synonyms | ESMLC; LC17; LC17-GI; LC17-NM; LC17A; LC17B; MLC-3; MLC1SM; MLC3NM; MLC3SM |
| Locus ID | 4637 |
| Cytogenetics | 12q13.2 |
| Summary | Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Vascular smooth muscle contraction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409203 | MYL6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC412144 | MYL6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409203 | Transient overexpression lysate of myosin, light chain 6, alkali, smooth muscle and non-muscle (MYL6), transcript variant 2 |
CNY 3080.00 |
|
| LY412144 | Transient overexpression lysate of myosin, light chain 6, alkali, smooth muscle and non-muscle (MYL6), transcript variant 1 |
CNY 3080.00 |
|
| PH300708 | MYL6 MS Standard C13 and N15-labeled recombinant protein (NP_066299) |
CNY 19520.00 |
|
| TP300708 | Recombinant protein of human myosin, light chain 6, alkali, smooth muscle and non-muscle (MYL6), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP324925 | Recombinant protein of human myosin, light chain 6, alkali, smooth muscle and non-muscle (MYL6), transcript variant 2, 20 µg |
CNY 2900.00 |
