Legumain (LGMN) (NM_005606) Human Mass Spec Standard
CAT#: PH324975
LGMN MS Standard C13 and N15-labeled recombinant protein (NP_005597)
View other "Legumain" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | LGMN MS Standard C13 and N15-labeled recombinant protein (NP_005597) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224975 |
Predicted MW | 49.4 kDa |
Protein Sequence |
>RC224975 protein sequence
Red=Cloning site Green=Tags(s) MVWKVAVFLSVALGIGAIPIDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIVVMM YDDIAYSEDNPTPGIVINRPNGTDVYQGVPKDYTGEDVTPQNFLAVLRGDAEAVKGIGSGKVLKSGPQDH VFIYFTDHGSTGILVFPNEDLHVKDLNETIHYMYKHKMYRKMVFYIEACESGSMMNHLPDNINVYATTAA NPRESSYACYYDEKRSTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKTISTMKV MQFQGMKRKASSPVPLPPVTHLDLTPSPDVPLTIMKRKLMNTNDLEESRQLTEEIQRHLDARHLIEKSVR KIVSLLAASEAEVEQLLSERAPLTGHSCYPEALLHFRTHCFNWHSPTYEYALRHLYVLVNLCEKPYPLHR IKLSMDHVCLGHY SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005597 |
RefSeq Size | 2073 |
RefSeq ORF | 1299 |
Synonyms | AEP; LGMN1; PRSC1 |
Locus ID | 5641 |
Cytogenetics | 14q32.12 |
Summary | This gene encodes a cysteine protease that has a strict specificity for hydrolysis of asparaginyl bonds. This enzyme may be involved in the processing of bacterial peptides and endogenous proteins for MHC class II presentation in the lysosomal/endosomal systems. Enzyme activation is triggered by acidic pH and appears to be autocatalytic. Protein expression occurs after monocytes differentiate into dendritic cells. A fully mature, active enzyme is produced following lipopolysaccharide expression in mature dendritic cells. Overexpression of this gene may be associated with the majority of solid tumor types. This gene has a pseudogene on chromosome 13. Several alternatively spliced transcript variants have been described, but the biological validity of only two has been determined. These two variants encode the same isoform. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Antigen processing and presentation, Lysosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400393 | LGMN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417185 | LGMN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400393 | Transient overexpression lysate of legumain (LGMN), transcript variant 2 |
CNY 3080.00 |
|
LY417185 | Transient overexpression lysate of legumain (LGMN), transcript variant 1 |
CNY 3080.00 |
|
TP324975 | Recombinant protein of human legumain (LGMN), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP720320 | Recombinant protein of human legumain (LGMN), transcript variant 2 |
CNY 1800.00 |
其它Legumain产品