SYCE3 (NM_001123225) Human Mass Spec Standard
CAT#: PH325004
C22orf41 MS Standard C13 and N15-labeled recombinant protein (NP_001116697)
View other "SYCE3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | C22orf41 MS Standard C13 and N15-labeled recombinant protein (NP_001116697) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC225004 |
| Predicted MW | 10.4 kDa |
| Protein Sequence |
>RC225004 representing NM_001123225
Red=Cloning site Green=Tags(s) MDDADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCK EEMEKNWQELLHETKQRL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001116697 |
| RefSeq ORF | 264 |
| Synonyms | C22orf41; THEG2 |
| Locus ID | 644186 |
| Cytogenetics | 22q13.33 |
| Summary | Major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Required for chromosome loading of the central element-specific SCS proteins, and for initiating synapsis between homologous chromosomes. Chromosome loading appears to require SYCP1. Required for fertility.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC426602 | SYCE3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY426602 | Transient overexpression lysate of chromosome 22 open reading frame 41 (C22orf41) |
CNY 3080.00 |
|
| TP325004 | Recombinant protein of human chromosome 22 open reading frame 41 (C22orf41), 20 µg |
CNY 2900.00 |
