NHLH2 (NM_001111061) Human Mass Spec Standard
CAT#: PH325102
NHLH2 MS Standard C13 and N15-labeled recombinant protein (NP_001104531)
View other "NHLH2" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NHLH2 MS Standard C13 and N15-labeled recombinant protein (NP_001104531) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC225102 |
| Predicted MW | 15 kDa |
| Protein Sequence |
>RC225102 protein sequence
Red=Cloning site Green=Tags(s) MMLSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRR RRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001104531 |
| RefSeq Size | 2501 |
| RefSeq ORF | 405 |
| Synonyms | bHLHa34; HEN2; NSCL2 |
| Locus ID | 4808 |
| Cytogenetics | 1p13.1 |
| Summary | May serve as DNA-binding protein and may be involved in the control of cell-type determination, possibly within the developing nervous system.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417197 | NHLH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426348 | NHLH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417197 | Transient overexpression lysate of nescient helix loop helix 2 (NHLH2), transcript variant 1 |
CNY 3080.00 |
|
| LY426348 | Transient overexpression lysate of nescient helix loop helix 2 (NHLH2), transcript variant 2 |
CNY 3080.00 |
|
| TP325102 | Recombinant protein of human nescient helix loop helix 2 (NHLH2), transcript variant 2, 20 µg |
CNY 2900.00 |
