SPG21 (NM_001127889) Human Mass Spec Standard
CAT#: PH325431
SPG21 MS Standard C13 and N15-labeled recombinant protein (NP_001121361)
View other "SPG21" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SPG21 MS Standard C13 and N15-labeled recombinant protein (NP_001121361) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225431 |
Predicted MW | 35 kDa |
Protein Sequence |
>RC225431 protein sequence
Red=Cloning site Green=Tags(s) MGEIKVSPDYNWFRGTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFFRQILALTGWG YRVIALQYPVYWDHLEFCDGFRKLLDHLQLDKVHLFGASLGGFLAQKFAEYTHKSPRVHSLILCNSFSDT SIFNQTWTANSFWLMPAFMLKKIVLGNFSSGPVDPMMADAIDFMVDRLESLGQSELASRLTLNCQNSYVE PHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTK YAAIDPSMVSAEELEVQKGSLGISQEEQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001121361 |
RefSeq Size | 1658 |
RefSeq ORF | 924 |
Synonyms | ABHD21; ACP33; BM-019; GL010; MAST |
Locus ID | 51324 |
Cytogenetics | 15q22.31 |
Summary | The protein encoded by this gene binds to the hydrophobic C-terminal amino acids of CD4 which are involved in repression of T cell activation. The interaction with CD4 is mediated by the noncatalytic alpha/beta hydrolase fold domain of this protein. It is thus proposed that this gene product modulates the stimulatory activity of CD4. Mutations in this gene are associated with autosomal recessive spastic paraplegia 21 (SPG21), also known as mast syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413881 | SPG21 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426876 | SPG21 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426877 | SPG21 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413881 | Transient overexpression lysate of spastic paraplegia 21 (autosomal recessive, Mast syndrome) (SPG21), transcript variant 1 |
CNY 3080.00 |
|
LY426876 | Transient overexpression lysate of spastic paraplegia 21 (autosomal recessive, Mast syndrome) (SPG21), transcript variant 2 |
CNY 3080.00 |
|
LY426877 | Transient overexpression lysate of spastic paraplegia 21 (autosomal recessive, Mast syndrome) (SPG21), transcript variant 3 |
CNY 3080.00 |
|
PH300071 | SPG21 MS Standard C13 and N15-labeled recombinant protein (NP_057714) |
CNY 19520.00 |
|
TP300071 | Recombinant protein of human spastic paraplegia 21 (autosomal recessive, Mast syndrome) (SPG21), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP325431 | Recombinant protein of human spastic paraplegia 21 (autosomal recessive, Mast syndrome) (SPG21), transcript variant 2, 20 µg |
CNY 2900.00 |