SPG21 (NM_001127889) Human Recombinant Protein
CAT#: TP325431
Recombinant protein of human spastic paraplegia 21 (autosomal recessive, Mast syndrome) (SPG21), transcript variant 2, 20 µg
View other "SPG21" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225431 protein sequence
Red=Cloning site Green=Tags(s) MGEIKVSPDYNWFRGTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFFRQILALTGWG YRVIALQYPVYWDHLEFCDGFRKLLDHLQLDKVHLFGASLGGFLAQKFAEYTHKSPRVHSLILCNSFSDT SIFNQTWTANSFWLMPAFMLKKIVLGNFSSGPVDPMMADAIDFMVDRLESLGQSELASRLTLNCQNSYVE PHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTK YAAIDPSMVSAEELEVQKGSLGISQEEQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001121361 |
Locus ID | 51324 |
UniProt ID | Q9NZD8 |
Refseq Size | 1658 |
Cytogenetics | 15q22.31 |
Refseq ORF | 924 |
Synonyms | ABHD21; ACP33; BM-019; GL010; MAST |
Summary | The protein encoded by this gene binds to the hydrophobic C-terminal amino acids of CD4 which are involved in repression of T cell activation. The interaction with CD4 is mediated by the noncatalytic alpha/beta hydrolase fold domain of this protein. It is thus proposed that this gene product modulates the stimulatory activity of CD4. Mutations in this gene are associated with autosomal recessive spastic paraplegia 21 (SPG21), also known as mast syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413881 | SPG21 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426876 | SPG21 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426877 | SPG21 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413881 | Transient overexpression lysate of spastic paraplegia 21 (autosomal recessive, Mast syndrome) (SPG21), transcript variant 1 |
CNY 3080.00 |
|
LY426876 | Transient overexpression lysate of spastic paraplegia 21 (autosomal recessive, Mast syndrome) (SPG21), transcript variant 2 |
CNY 3080.00 |
|
LY426877 | Transient overexpression lysate of spastic paraplegia 21 (autosomal recessive, Mast syndrome) (SPG21), transcript variant 3 |
CNY 3080.00 |
|
PH300071 | SPG21 MS Standard C13 and N15-labeled recombinant protein (NP_057714) |
CNY 19520.00 |
|
PH325431 | SPG21 MS Standard C13 and N15-labeled recombinant protein (NP_001121361) |
CNY 19520.00 |
|
TP300071 | Recombinant protein of human spastic paraplegia 21 (autosomal recessive, Mast syndrome) (SPG21), transcript variant 1, 20 µg |
CNY 2900.00 |