MSF (SEPT9) (NM_001113496) Human Mass Spec Standard
CAT#: PH325490
SEPT9 MS Standard C13 and N15-labeled recombinant protein (NP_001106968)
View other "MSF" proteins (13)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | SEPT9 MS Standard C13 and N15-labeled recombinant protein (NP_001106968) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225490 |
Predicted MW | 38.3 kDa |
Protein Sequence |
>RC225490 representing NM_001113496
Red=Cloning site Green=Tags(s) MADTPRDAGLKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFEFNIMVVGQSGLGKSTLINTLFKS KISRKSVQPTSEERIPKTIEIKSITHDIEEKGVRMKLTVIDTPGFGDHINNENCWQPIMKFINDQYEKYL QEEVNINRKKRIPDTRVHCCLYFIPATGHSLRPLDIEFMKRLSKVVNIVPVIAKADTLTLEERVHFKQRI TADLLSNGIDVYPQKEFDEDSEDRLVNEKFREMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHC EFAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGMEEKEPEAPEM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001106968 |
RefSeq ORF | 1005 |
Synonyms | AF17q25; MSF; MSF1; NAPB; PNUTL4; SEPT9; SeptD1; SINT1 |
Locus ID | 10801 |
Cytogenetics | 17q25.3 |
Summary | This gene is a member of the septin family involved in cytokinesis and cell cycle control. This gene is a candidate for the ovarian tumor suppressor gene. Mutations in this gene cause hereditary neuralgic amyotrophy, also known as neuritis with brachial predilection. A chromosomal translocation involving this gene on chromosome 17 and the MLL gene on chromosome 11 results in acute myelomonocytic leukemia. Multiple alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Mar 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401986 | 42256 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426417 | 42256 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426419 | 42256 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426421 | 42256 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426422 | 42256 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401986 | Transient overexpression lysate of septin 9 (SEPT9), transcript variant 3 |
CNY 3080.00 |
|
LY426417 | Transient overexpression lysate of septin 9 (SEPT9), transcript variant 1 |
CNY 3080.00 |
|
LY426419 | Transient overexpression lysate of septin 9 (SEPT9), transcript variant 2 |
CNY 3080.00 |
|
LY426421 | Transient overexpression lysate of septin 9 (SEPT9), transcript variant 4 |
CNY 3080.00 |
|
LY426422 | Transient overexpression lysate of septin 9 (SEPT9), transcript variant 7 |
CNY 3080.00 |
|
PH300264 | SEPT9 MS Standard C13 and N15-labeled recombinant protein (NP_006631) |
CNY 19520.00 |
|
TP300264 | Recombinant protein of human septin 9 (SEPT9), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP325490 | Purified recombinant protein of Homo sapiens septin 9 (SEPT9), transcript variant 7, 20 µg |
CNY 2900.00 |