NDRG1 (NM_001135242) Human Mass Spec Standard
CAT#: PH325609
NDRG1 MS Standard C13 and N15-labeled recombinant protein (NP_001128714)
View other "NDRG1" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NDRG1 MS Standard C13 and N15-labeled recombinant protein (NP_001128714) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC225609 |
| Predicted MW | 42.8 kDa |
| Protein Sequence |
>RC225609 protein sequence
Red=Cloning site Green=Tags(s) MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHK TCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTG AGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHT YRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTK TTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGT RSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001128714 |
| RefSeq Size | 3520 |
| RefSeq ORF | 1182 |
| Synonyms | CAP43; CMT4D; DRG-1; DRG1; GC4; HMSNL; NDR1; NMSL; PROXY1; RIT42; RTP; TARG1; TDD5 |
| Locus ID | 10397 |
| Cytogenetics | 8q24.22 |
| Summary | This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. The encoded protein is necessary for p53-mediated caspase activation and apoptosis. Mutations in this gene are a cause of Charcot-Marie-Tooth disease type 4D, and expression of this gene may be a prognostic indicator for several types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401840 | NDRG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427604 | NDRG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401840 | Transient overexpression lysate of N-myc downstream regulated 1 (NDRG1), transcript variant 2 |
CNY 3080.00 |
|
| LY427604 | Transient overexpression lysate of N-myc downstream regulated 1 (NDRG1), transcript variant 1 |
CNY 3080.00 |
|
| PH301374 | NDRG1 MS Standard C13 and N15-labeled recombinant protein (NP_006087) |
CNY 19520.00 |
|
| TP301374 | Recombinant protein of human N-myc downstream regulated 1 (NDRG1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP325609 | Recombinant protein of human N-myc downstream regulated 1 (NDRG1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP720621 | Purified recombinant protein of Human N-myc downstream regulated 1 (NDRG1), transcript variant 2 |
CNY 1800.00 |
