NDRG1 (NM_001135242) Human Mass Spec Standard
CAT#: PH325609
NDRG1 MS Standard C13 and N15-labeled recombinant protein (NP_001128714)
View other "NDRG1" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | NDRG1 MS Standard C13 and N15-labeled recombinant protein (NP_001128714) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225609 |
Predicted MW | 42.8 kDa |
Protein Sequence |
>RC225609 protein sequence
Red=Cloning site Green=Tags(s) MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHK TCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTG AGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHT YRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTK TTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGT RSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001128714 |
RefSeq Size | 3520 |
RefSeq ORF | 1182 |
Synonyms | CAP43; CMT4D; DRG-1; DRG1; GC4; HMSNL; NDR1; NMSL; PROXY1; RIT42; RTP; TARG1; TDD5 |
Locus ID | 10397 |
Cytogenetics | 8q24.22 |
Summary | This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. The encoded protein is necessary for p53-mediated caspase activation and apoptosis. Mutations in this gene are a cause of Charcot-Marie-Tooth disease type 4D, and expression of this gene may be a prognostic indicator for several types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401840 | NDRG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427604 | NDRG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401840 | Transient overexpression lysate of N-myc downstream regulated 1 (NDRG1), transcript variant 2 |
CNY 3,080.00 |
|
LY427604 | Transient overexpression lysate of N-myc downstream regulated 1 (NDRG1), transcript variant 1 |
CNY 3,080.00 |
|
PH301374 | NDRG1 MS Standard C13 and N15-labeled recombinant protein (NP_006087) |
CNY 19,520.00 |
|
TP301374 | Recombinant protein of human N-myc downstream regulated 1 (NDRG1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP325609 | Recombinant protein of human N-myc downstream regulated 1 (NDRG1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP720621 | Purified recombinant protein of Human N-myc downstream regulated 1 (NDRG1), transcript variant 2 |
CNY 5,460.00 |