SIGIRR (NM_001135054) Human Mass Spec Standard
CAT#: PH325643
SIGIRR MS Standard C13 and N15-labeled recombinant protein (NP_001128526)
View other "SIGIRR" proteins (12)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SIGIRR MS Standard C13 and N15-labeled recombinant protein (NP_001128526) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225643 |
Predicted MW | 45.7 kDa |
Protein Sequence |
>RC225643 protein sequence
Red=Cloning site Green=Tags(s) MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWV KANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSHVAAVLASLLVLLALLLAALLYV KCRLNVLLWYQDAYGEVEINDGKLYDAYVSYSDCPEDRKFVNFILKPQLERRRGYKLFLDDRDLLPRAEP SADLLVNLSRCRRLIVVLSDAFLSRAWCSHSFREGLCRLLELTRRPIFITFEGQRRDPAHPALRLLRQHR HLVTLLLWRPGSVTPSSDFWKEVQLALPRKVRYRPVEGDPQTQLQDDKDPMLILRGRVPEGRALDSEVDP DPEGDLGVRGPVFGEPSAPPHTSGVSLGESRSSEVDVSDLGSRNYSARTDFYCLVSKDDM SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001128526 |
RefSeq Size | 1761 |
RefSeq ORF | 1230 |
Synonyms | IL-1R8; TIR8 |
Locus ID | 59307 |
Cytogenetics | 11p15.5 |
Summary | Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its extracellular domain interferes with the heterodimerization of Il1R1 and IL1RAP.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402876 | SIGIRR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427540 | SIGIRR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427541 | SIGIRR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402876 | Transient overexpression lysate of single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 3 |
CNY 3080.00 |
|
LY427540 | Transient overexpression lysate of single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 2 |
CNY 3080.00 |
|
LY427541 | Transient overexpression lysate of single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 1 |
CNY 3080.00 |
|
PH301356 | SIGIRR MS Standard C13 and N15-labeled recombinant protein (NP_068577) |
CNY 14250.00 |
|
PH325642 | SIGIRR MS Standard C13 and N15-labeled recombinant protein (NP_001128525) |
CNY 19520.00 |
|
TP301356 | Purified recombinant protein of Homo sapiens single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP325642 | Recombinant protein of human single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP325643 | Recombinant protein of human single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP762571 | Purified recombinant protein of Human single immunoglobulin and toll-interleukin 1 receptor (TIR) domain (SIGIRR), transcript variant 3, 50ug |
CNY 2480.00 |