SH3BP2 (NM_001122681) Human Mass Spec Standard
CAT#: PH325960
SH3BP2 MS Standard C13 and N15-labeled recombinant protein (NP_001116153)
View other "SH3BP2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SH3BP2 MS Standard C13 and N15-labeled recombinant protein (NP_001116153) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC225960 |
| Predicted MW | 62.2 kDa |
| Protein Sequence |
>RC225960 protein sequence
Red=Cloning site Green=Tags(s) MAAEEMHWPVPMKAIGAQNLLTMPGGVAKAGYLHKKGGTQLQLLKWPLRFVIIHKRCVYYFKSSTSASPQ GAFSLSGYNRVMRAAEETTSNNVFPFKIIHISKKHRTWFFSASSEEERKSWMALLRREIGHFHEKKDLPL DTSDSSSDTDSFYGAVERPVDISLSPYPTDNEDYEHDDEDDSYLEPDSPEPGRLEDALMHPPAYPPPPVP TPRKPAFSDMPRAHSFTSKGPGPLLPPPPPKHGLPDVGLAAEDSKRDPLCPRRAEPCPRVPATPRRMSDP PLSTMPTAPGLRKPPCFRESASPSPEPWTPGHGACSTSSAAIMATATSRNCDKLKSFHLSPRGPPTSEPP PVPANKPKFLKIAEEDPPREAAMPGLFVPPVAPRPPALKLPVPEAMARPAVLPRPEKPQLPHLQRSPPDG QSFRSFSFEKPRQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNS STKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHYHTHVLPSHQSLLLRHPYGYTGP R myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001116153 |
| RefSeq Size | 9068 |
| RefSeq ORF | 1683 |
| Synonyms | 3BP-2; 3BP2; CRBM; CRPM; RES4-23 |
| Locus ID | 6452 |
| Cytogenetics | 4p16.3 |
| Summary | The protein encoded by this gene has an N-terminal pleckstrin homology (PH) domain, an SH3-binding proline-rich region, and a C-terminal SH2 domain. The protein binds to the SH3 domains of several proteins including the ABL1 and SYK protein tyrosine kinases , and functions as a cytoplasmic adaptor protein to positively regulate transcriptional activity in T, natural killer (NK), and basophilic cells. Mutations in this gene result in cherubism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009] |
| Protein Families | Druggable Genome |
| Protein Pathways | Natural killer cell mediated cytotoxicity |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401057 | SH3BP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426549 | SH3BP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401057 | Transient overexpression lysate of SH3-domain binding protein 2 (SH3BP2), transcript variant 1 |
CNY 3080.00 |
|
| LY426549 | Transient overexpression lysate of SH3-domain binding protein 2 (SH3BP2), transcript variant 2 |
CNY 3080.00 |
|
| PH305759 | SH3BP2 MS Standard C13 and N15-labeled recombinant protein (NP_003014) |
CNY 19520.00 |
|
| TP305759 | Recombinant protein of human SH3-domain binding protein 2 (SH3BP2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP325960 | Recombinant protein of human SH3-domain binding protein 2 (SH3BP2), transcript variant 2, 20 µg |
CNY 2900.00 |
