Breast cancer suppressor candidate 1 (VWA5A) (NM_001130142) Human Mass Spec Standard
CAT#: PH326168
VWA5A MS Standard C13 and N15-labeled recombinant protein (NP_001123614)
View other "Breast cancer suppressor candidate 1" proteins (13)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 4840.00
Specifications
Product Data | |
Description | VWA5A MS Standard C13 and N15-labeled recombinant protein (NP_001123614) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226168 |
Predicted MW | 86.3 kDa |
Protein Sequence |
>RC226168 representing NM_001130142
Red=Cloning site Green=Tags(s) MVHFCGLLTLHREPVPLKSISVSVNIYEFVAGVSATLNYENEEKVPLEAFFVFPMDEDSAVYSFEALVDG KKIVAELQDKMKARTNYEKAISQGHQAFLLEGDSSSRDVFSCNVGNLQPGSKAAVTLKYVQELPLEADGA LRFVLPAVLNPRYQFSGSSKDSCLNVKTPIVPVEDLPYTLSMVATIDSQHGIEKVQSNCPLSPTEYLGED KTSAQVSLAAGHKFDRDVELLIYYNEVHTPSVVLEMGMPNMKPGHLMGDPSAMVSFYPNIPEDQPSNTCG EFIFLMDRSGSMQSPMSSQDTSQLRIQAAKETLILLLKSLPIGCYFNIYGFGSSYEACFPESVKYTQQTM EEALGRVKLMQADLGGTEILAPLQNIYRGPSIPGHPLQLFVFTDGEVTDTFSVIKEVRINRQKHRCFSFG IGEGTSTSLIKGIARASGGTSEFITGKDRMQSKALRTLKRSLQPVVEDVSLSWHLPPGLSAKMLSPEQTV IFRGQRLISYAQLTGRMPAAETTGEVCLKYTLQGKTFEDKVTFPLQPKPDVNLTIHRLAAKSLLQTKDMG LRETPASDKKDALNLSLESGVISSFTAFIAINKELNKPVQGPLAHRDVPRPILLGASAPLKIKCQSGFRK ALHSDRPPSASQPRGELMCYKAKTFQMDDYSLCGLISHKDQHSPGFGENHLVQLIYHQNANGSWDLNEDL AKILGMSLEEIMAAQPAELVDSSGWATILAVIWLHSNGKDLKCEWELLERKAVAWMRAHAGSTMPSVVKA AITFLKSSVDPAIFAF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001123614 |
RefSeq ORF | 2358 |
Synonyms | BCSC-1; BCSC1; LOH11CR2A |
Locus ID | 4013 |
Cytogenetics | 11q24.2 |
Summary | May play a role in tumorigenesis as a tumor suppressor. Altered expression of this protein and disruption of the molecular pathway it is involved in, may contribute directly to or modify tumorigenesis.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402354 | VWA5A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC405013 | VWA5A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427178 | VWA5A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY402354 | Transient overexpression lysate of von Willebrand factor A domain containing 5A (VWA5A), transcript variant 1 |
CNY 4840.00 |
|
LY405013 | Transient overexpression lysate of von Willebrand factor A domain containing 5A (VWA5A), transcript variant 2 |
CNY 3080.00 |
|
LY427178 | Transient overexpression lysate of von Willebrand factor A domain containing 5A (VWA5A), transcript variant 3 |
CNY 4840.00 |
|
PH301474 | VWA5A MS Standard C13 and N15-labeled recombinant protein (NP_938057) |
CNY 19520.00 |
|
PH312185 | VWA5A MS Standard C13 and N15-labeled recombinant protein (NP_055437) |
CNY 19520.00 |
|
TP301474 | Recombinant protein of human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP312185 | Recombinant protein of human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP326168 | Recombinant protein of human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP710317 | Purified recombinant protein of Human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
|
TP761749 | Purified recombinant protein of Human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 2, full length, with N-terminal His tag, expressed in E. coli, 50ug |
CNY 2040.00 |
其它Breast cancer suppressor candidate 1产品