ABH2 (ALKBH2) (NM_001145374) Human Mass Spec Standard
CAT#: PH326507
ALKBH2 MS Standard C13 and N15-labeled recombinant protein (NP_001138846)
View other "ABH2" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ALKBH2 MS Standard C13 and N15-labeled recombinant protein (NP_001138846) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC226507 |
| Predicted MW | 29.3 kDa |
| Protein Sequence |
>RC226507 protein sequence
Red=Cloning site Green=Tags(s) MDRFLVKGAQGGLLRKQEEQEPTGEEPAVLGGDKESTRKRPRREAPGNGGHSAGPSWRHIRAEGLDCSYT VLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLER IRDHVSGVTGQTFNFVLINRYKDGCDHIGEHRDDERELAPGSPIASVSFGACRDFVFRHKDSRGKSPSRR VAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILLTKK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001138846 |
| RefSeq Size | 1206 |
| RefSeq ORF | 783 |
| Synonyms | ABH2 |
| Locus ID | 121642 |
| Cytogenetics | 12q24.11 |
| Summary | The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 and ALKBH3 (MIM 610603) are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine (Duncan et al., 2002 [PubMed 12486230]).[supplied by OMIM, Mar 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400362 | ALKBH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428853 | ALKBH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428854 | ALKBH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400362 | Transient overexpression lysate of alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 2 |
CNY 3080.00 |
|
| LY428853 | Transient overexpression lysate of alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 1 |
CNY 3080.00 |
|
| LY428854 | Transient overexpression lysate of alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 3 |
CNY 3080.00 |
|
| PH310103 | ALKBH2 MS Standard C13 and N15-labeled recombinant protein (NP_001001655) |
CNY 19520.00 |
|
| PH326527 | ALKBH2 MS Standard C13 and N15-labeled recombinant protein (NP_001138847) |
CNY 19520.00 |
|
| TP310103 | Recombinant protein of human alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP326507 | Recombinant protein of human alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP326527 | Recombinant protein of human alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 3, 20 µg |
CNY 2900.00 |
