RAB34 (NM_001144943) Human Mass Spec Standard
CAT#: PH326508
RAB34 MS Standard C13 and N15-labeled recombinant protein (NP_001138415)
View other "RAB34" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | RAB34 MS Standard C13 and N15-labeled recombinant protein (NP_001138415) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC226508 |
| Predicted MW | 35 kDa |
| Protein Sequence |
>RC226508 representing NM_001144943
Red=Cloning site Green=Tags(s) MSHLPGLELRREAPPLLGPLLSPFPLPAGSWHRQMLRSSLRFPITNSAGAPCKAAGRMNILAPVRRDRVL AELPQCLRKEAALHGHKDFHPRVTCACQEHRTGTVGFKISKVIVVGDLSVGKTCLINRFCKDTFDKNYKA TIGVDFEMERFEVLGIPFSLQLWDTAGQERFKCIASTYYRGAQAIIIVFNLNDVASLEHTKQWLADALKE NDPSSVLLFLVGSKKDLSTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLA ELEKSGARRIGDVVRINSDDSNLYLTASKKKPTCCP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001138415 |
| RefSeq ORF | 948 |
| Synonyms | NARR; RAB39; RAH |
| Locus ID | 83871 |
| Cytogenetics | 17q11.2 |
| Summary | This gene encodes a protein belonging to the RAB family of proteins, which are small GTPases involved in protein transport. This family member is a Golgi-bound member of the secretory pathway that is involved in the repositioning of lysosomes and the activation of macropinocytosis. Alternative splicing of this gene results in multiple transcript variants. An alternatively spliced transcript variant produces the nine-amino acid residue-repeats (NARR) protein, which is a functionally distinct nucleolar protein resulting from a different reading frame. [provided by RefSeq, Dec 2016] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403132 | RAB34 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428219 | RAB34 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428594 | RAB34 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428595 | RAB34 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403132 | Transient overexpression lysate of RAB34, member RAS oncogene family (RAB34), transcript variant 1 |
CNY 3080.00 |
|
| LY428219 | Transient overexpression lysate of RAB34, member RAS oncogene family (RAB34), transcript variant 3 |
CNY 3080.00 |
|
| LY428594 | Transient overexpression lysate of RAB34, member RAS oncogene family (RAB34), transcript variant 5 |
CNY 3080.00 |
|
| LY428595 | Transient overexpression lysate of RAB34, member RAS oncogene family (RAB34), transcript variant 8 |
CNY 3080.00 |
|
| PH309722 | RAB34 MS Standard C13 and N15-labeled recombinant protein (NP_114140) |
CNY 19520.00 |
|
| TP309722 | Recombinant protein of human RAB34, member RAS oncogene family (RAB34), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP326508 | Purified recombinant protein of Homo sapiens RAB34, member RAS oncogene family (RAB34), transcript variant 8, 20 µg |
CNY 2900.00 |
