SAR1 (SAR1A) (NM_001142648) Human Mass Spec Standard
CAT#: PH326577
SAR1A MS Standard C13 and N15-labeled recombinant protein (NP_001136120)
View other "SAR1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SAR1A MS Standard C13 and N15-labeled recombinant protein (NP_001136120) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226577 |
Predicted MW | 22.4 kDa |
Protein Sequence |
>RC226577 protein sequence
Red=Cloning site Green=Tags(s) MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMT FTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLVESKVELNALMTDETISNVPILILGNKIDRTD AISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSVLKRQGYGEGFRWLSQYID myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001136120 |
RefSeq Size | 3088 |
RefSeq ORF | 594 |
Synonyms | masra2; SAR1; Sara; SARA1 |
Locus ID | 56681 |
Cytogenetics | 10q22.1 |
Summary | Involved in transport from the endoplasmic reticulum to the Golgi apparatus (By similarity). Required to maintain SEC16A localization at discrete locations on the ER membrane perhaps by preventing its dissociation. SAR1A-GTP-dependent assembly of SEC16A on the ER membrane forms an organized scaffold defining endoplasmic reticulum exit sites (ERES).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402753 | SAR1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428231 | SAR1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402753 | Transient overexpression lysate of SAR1 homolog A (S. cerevisiae) (SAR1A), transcript variant 2 |
CNY 3080.00 |
|
LY428231 | Transient overexpression lysate of SAR1 homolog A (S. cerevisiae) (SAR1A), transcript variant 1 |
CNY 3080.00 |
|
PH301450 | SAR1A MS Standard C13 and N15-labeled recombinant protein (NP_064535) |
CNY 19520.00 |
|
TP301450 | Recombinant protein of human SAR1 homolog A (S. cerevisiae) (SAR1A), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP326577 | Recombinant protein of human SAR1 homolog A (S. cerevisiae) (SAR1A), transcript variant 1, 20 µg |
CNY 2900.00 |