NCR1 (NM_001145458) Human Mass Spec Standard
CAT#: PH326814
NCR1 MS Standard C13 and N15-labeled recombinant protein (NP_001138930)
View other "NCR1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | NCR1 MS Standard C13 and N15-labeled recombinant protein (NP_001138930) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC226814 |
| Predicted MW | 32.4 kDa |
| Protein Sequence |
>RC226814 representing NM_001145458
Red=Cloning site Green=Tags(s) MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVD RPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKV TFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLV TGDIENTSLAPEDPTFPDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRR RLNTQTL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001138930 |
| RefSeq ORF | 861 |
| Synonyms | CD335; LY94; NK-p46; NKP46 |
| Locus ID | 9437 |
| Cytogenetics | 19q13.42 |
| Summary | Cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Natural killer cell mediated cytotoxicity |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417717 | NCR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428900 | NCR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417717 | Transient overexpression lysate of natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 1 |
CNY 3080.00 |
|
| LY428900 | Transient overexpression lysate of natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 2 |
CNY 3080.00 |
|
| TP326814 | Purified recombinant protein of Homo sapiens natural cytotoxicity triggering receptor 1 (NCR1), transcript variant 3, 20 µg |
CNY 2900.00 |
