CNGB1 (NM_001135639) Human Mass Spec Standard
CAT#: PH326950
CNGB1 MS Standard C13 and N15-labeled recombinant protein (NP_001129111)
View other "CNGB1" proteins (1)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | CNGB1 MS Standard C13 and N15-labeled recombinant protein (NP_001129111) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC226950 |
| Predicted MW | 32.4 kDa |
| Protein Sequence |
>RC226950 representing NM_001135639
Red=Cloning site Green=Tags(s) MLGWVQRVLPQPPGTPRKTKMQEEEEVEPEPEMEAEVEPEPNPEEAETESESMPPEESFKEEEVAVADPS PQETKEAALTSTISLRAQGAEISEMNSPSRRVLTWLMKGVEKVIPQPVHSITEDPAQILGHGSTGDTGCT DEPNEALEAQDTRPGLRLLLWLEQNLERVLPQPPKSSEVWRDEPAVATGAASDPAPPGRPQEMGPKLQAR ETPSLPTPIPLQPKEEPKEAPAPEPQPGSQAQTSSLPPTRDPARLVAWVLHRLEMALPQPVLHGKIGEQE PDSPGICDVQTRVMGAGGL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001129111 |
| RefSeq ORF | 897 |
| Synonyms | CNCG2; CNCG3L; CNCG4; CNG4; CNGB1B; GAR1; GARP; GARP2; RCNC2; RCNCb; RCNCbeta; RP45 |
| Locus ID | 1258 |
| Cytogenetics | 16q21 |
| Summary | In humans, the rod photoreceptor cGMP-gated cation channel helps regulate ion flow into the rod photoreceptor outer segment in response to light-induced alteration of the levels of intracellular cGMP. This channel consists of two subunits, alpha and beta, with the protein encoded by this gene representing the beta subunit. Defects in this gene are a cause of cause of retinitis pigmentosa type 45. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2013] |
| Protein Families | Druggable Genome, Ion Channels: Cyclic nucleotide gated |
| Protein Pathways | Olfactory transduction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| TP326950 | Recombinant protein of human cyclic nucleotide gated channel beta 1 (CNGB1), transcript variant 2, 20 µg |
CNY 2900.00 |
