C17orf49 (NM_001142799) Human Mass Spec Standard
CAT#: PH326977
C17orf49 MS Standard C13 and N15-labeled recombinant protein (NP_001136271)
View other "C17orf49" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | C17orf49 MS Standard C13 and N15-labeled recombinant protein (NP_001136271) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226977 |
Predicted MW | 13.8 kDa |
Protein Sequence |
>RC226977 representing NM_001142799
Red=Cloning site Green=Tags(s) MTSASTKVGEIFSAAGAAFTKLGELTMQLHPVADSSPAGAQIKATVKRKVYEDSGIPLPAESPKKGPKKV ASGVLSPPPAAPPPSSSSVPEAGGPPIKKQKADVTLSALNDSDANSDVVDIEGLGETPPAKKLNFDQA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001136271 |
RefSeq ORF | 414 |
Synonyms | BAP18; HEPIS |
Locus ID | 124944 |
Cytogenetics | 17p13.1 |
Summary | Component of chromatin complexes such as the MLL1/MLL and NURF complexes.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406297 | C17orf49 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428281 | C17orf49 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406297 | Transient overexpression lysate of chromosome 17 open reading frame 49 (C17orf49), transcript variant 2 |
CNY 3080.00 |
|
LY428281 | Transient overexpression lysate of chromosome 17 open reading frame 49 (C17orf49), transcript variant 3 |
CNY 3080.00 |
|
TP326977 | Recombinant protein of human chromosome 17 open reading frame 49 (C17orf49), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP761002 | Purified recombinant protein of Human chromosome 17 open reading frame 49 (C17orf49), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.coli, 50ug |
CNY 2040.00 |
其它C17orf49产品