TMEM169 (NM_001142310) Human Mass Spec Standard
CAT＃: PH327010
TMEM169 MS Standard C13 and N15-labeled recombinant protein (NP_001135782)
View other "TMEM169" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Product images
Specifications
| Product Data | |
| Description | TMEM169 MS Standard C13 and N15-labeled recombinant protein (NP_001135782) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC227010 |
| Predicted MW | 33.6 kDa |
| Protein Sequence |
>RC227010 protein sequence
Red=Cloning site Green=Tags(s) MEEPTAVEGQVQLPSPHQGSLRKAVAAALALDGESTMGHRKKKRKESRPESIIIYRSDNEKTDEEPGESE GGDQPKEEEGDDFLDYPVDDDMWNLPLDSRYVTLTGTITRGKKKGQMVDIHVTLTEKELQELTKPKESSR ETTPEGRMACQMGADRGPHVVLWTLICLPVVFILSFVVSFYYGTITWYNIFLVYNEERTFWHKISYCPCL VLFYPVLIMAMASSLGLYAAVVQLSWSWEAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLESDNIS STLSNKDPIQEVETSTV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001135782 |
| RefSeq Size | 3477 |
| RefSeq ORF | 891 |
| Locus ID | 92691 |
| Cytogenetics | 2q35 |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408654 | TMEM169 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408654 | Transient overexpression lysate of transmembrane protein 169 (TMEM169), transcript variant 3 |
CNY 3080.00 |
|
| PH303846 | TMEM169 MS Standard C13 and N15-labeled recombinant protein (NP_612399) |
CNY 19520.00 |
|
| PH327014 | TMEM169 MS Standard C13 and N15-labeled recombinant protein (NP_001135783) |
CNY 14250.00 |
|
| PH327027 | TMEM169 MS Standard C13 and N15-labeled recombinant protein (NP_001135784) |
CNY 14250.00 |
|
| TP303846 | Recombinant protein of human transmembrane protein 169 (TMEM169), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP327010 | Purified recombinant protein of Homo sapiens transmembrane protein 169 (TMEM169), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP327014 | Purified recombinant protein of Homo sapiens transmembrane protein 169 (TMEM169), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP327027 | Purified recombinant protein of Homo sapiens transmembrane protein 169 (TMEM169), transcript variant 4, 20 µg |
CNY 2900.00 |
其它TMEM169产品
