Synaptotagmin 1 (SYT1) (NM_001135805) Human Mass Spec Standard
CAT#: PH327105
SYT1 MS Standard C13 and N15-labeled recombinant protein (NP_001129277)
View other "Synaptotagmin 1" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SYT1 MS Standard C13 and N15-labeled recombinant protein (NP_001129277) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC227105 |
Predicted MW | 47.4 kDa |
Protein Sequence |
>RC227105 representing NM_001135805
Red=Cloning site Green=Tags(s) MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWALIAIAIVAVL LVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEE EKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQ FTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFS LRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPF EQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAV KK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001129277 |
RefSeq ORF | 1266 |
Synonyms | BAGOS; P65; SVP65; SYT |
Locus ID | 6857 |
Cytogenetics | 12q21.2 |
Summary | The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Calcium binding to synaptotagmin-1 participates in triggering neurotransmitter release at the synapse (Fernandez-Chacon et al., 2001 [PubMed 11242035]).[supplied by OMIM, Jul 2010] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417170 | SYT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427710 | SYT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427711 | SYT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417170 | Transient overexpression lysate of synaptotagmin I (SYT1), transcript variant 1 |
CNY 3080.00 |
|
LY427710 | Transient overexpression lysate of synaptotagmin I (SYT1), transcript variant 2 |
CNY 3080.00 |
|
LY427711 | Transient overexpression lysate of synaptotagmin I (SYT1), transcript variant 3 |
CNY 3080.00 |
|
PH308938 | SYT1 MS Standard C13 and N15-labeled recombinant protein (NP_005630) |
CNY 14250.00 |
|
PH327252 | SYT1 MS Standard C13 and N15-labeled recombinant protein (NP_001129278) |
CNY 19520.00 |
|
TP308938 | Purified recombinant protein of Homo sapiens synaptotagmin I (SYT1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP327105 | Recombinant protein of human synaptotagmin I (SYT1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP327252 | Recombinant protein of human synaptotagmin I (SYT1), transcript variant 3, 20 µg |
CNY 2900.00 |
其它Synaptotagmin 1产品