WIBG (PYM1) (NM_001143853) Human Mass Spec Standard
CAT#: PH327106
WIBG MS Standard C13 and N15-labeled recombinant protein (NP_001137325)
View other "WIBG" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
Product Data | |
Description | WIBG MS Standard C13 and N15-labeled recombinant protein (NP_001137325) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC227106 |
Predicted MW | 22.5 kDa |
Protein Sequence |
>RC227106 representing NM_001143853
Red=Cloning site Green=Tags(s) MATPYVTDETGGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAPV TPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASDQ PDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001137325 |
RefSeq ORF | 609 |
Synonyms | PYM; WIBG |
Locus ID | 84305 |
Cytogenetics | 12q13.2 |
Summary | Key regulator of the exon junction complex (EJC), a multiprotein complex that associates immediately upstream of the exon-exon junction on mRNAs and serves as a positional landmark for the intron exon structure of genes and directs post-transcriptional processes in the cytoplasm such as mRNA export, nonsense-mediated mRNA decay (NMD) or translation. Acts as an EJC disassembly factor, allowing translation-dependent EJC removal and recycling by disrupting mature EJC from spliced mRNAs. Its association with the 40S ribosomal subunit probably prevents a translation-independent disassembly of the EJC from spliced mRNAs, by restricting its activity to mRNAs that have been translated. Interferes with NMD and enhances translation of spliced mRNAs, probably by antagonizing EJC functions. May bind RNA; the relevance of RNA-binding remains unclear in vivo, RNA-binding was detected by PubMed:14968132, while PubMed:19410547 did not detect RNA-binding activity independently of the EJC.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410182 | WIBG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428389 | WIBG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410182 | Transient overexpression lysate of within bgcn homolog (Drosophila) (WIBG), transcript variant 1 |
CNY 3080.00 |
|
LY428389 | Transient overexpression lysate of within bgcn homolog (Drosophila) (WIBG), transcript variant 2 |
CNY 3080.00 |
|
PH302988 | WIBG MS Standard C13 and N15-labeled recombinant protein (NP_115721) |
CNY 19520.00 |
|
TP302988 | Recombinant protein of human within bgcn homolog (Drosophila) (WIBG), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP327106 | Recombinant protein of human within bgcn homolog (Drosophila) (WIBG), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP720529 | Recombinant protein of human within bgcn homolog (Drosophila) (WIBG), transcript variant 2 |
CNY 1800.00 |