SMAD6 (NM_001142861) Human Mass Spec Standard
CAT#: PH327610
SMAD6 MS Standard C13 and N15-labeled recombinant protein (NP_001136333)
View other "SMAD6" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SMAD6 MS Standard C13 and N15-labeled recombinant protein (NP_001136333) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC227610 |
| Predicted MW | 26.1 kDa |
| Protein Sequence |
>RC227610 representing NM_001142861
Red=Cloning site Green=Tags(s) MSRMGKPIETQKSPPPPYSRLSPRDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHW CSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTRSKIGFGILLSKEPDGVW AYNRGEHPIFVNSPTLDAPGGRALVVRKVPPGYSIKVFDFERSGLQHAPEPDAADGPYDPNSVRISFAKG WGPCYSRQFITSCPCWLEILLNNPR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001136333 |
| RefSeq ORF | 705 |
| Synonyms | AOVD2; HsT17432; MADH6; MADH7 |
| Locus ID | 4091 |
| Cytogenetics | 15q22.31 |
| Summary | The protein encoded by this gene belongs to the SMAD family of proteins, which are related to Drosophila 'mothers against decapentaplegic' (Mad) and C. elegans Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions in the negative regulation of BMP and TGF-beta/activin-signalling. Multiple transcript variants have been found for this gene.[provided by RefSeq, Sep 2014] |
| Protein Families | Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors |
| Protein Pathways | TGF-beta signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC428291 | SMAD6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY428291 | Transient overexpression lysate of SMAD family member 6 (SMAD6), transcript variant 2 |
CNY 3080.00 |
|
| TP327610 | Recombinant protein of human SMAD family member 6 (SMAD6), transcript variant 2, 20 µg |
CNY 2900.00 |
