DHRS1 (NM_001136050) Human Mass Spec Standard
CAT＃: PH327656
DHRS1 MS Standard C13 and N15-labeled recombinant protein (NP_001129522)
View other "DHRS1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | DHRS1 MS Standard C13 and N15-labeled recombinant protein (NP_001129522) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC227656 |
| Predicted MW | 33.9 kDa |
| Protein Sequence |
>RC227656 protein sequence
Red=Cloning site Green=Tags(s) MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESE VRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVP AGQGLIVVISSPGSLQYMFNVLYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEV LQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSS VLSHVSGLGWLASYLPSFLRVPKWIIALYTSKF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001129522 |
| RefSeq Size | 1495 |
| RefSeq ORF | 939 |
| Synonyms | SDR19C1 |
| Locus ID | 115817 |
| Cytogenetics | 14q12 |
| Summary | This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded enzyme contains a conserved catalytic domain and likely functions as an oxidoreductase. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408602 | DHRS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427794 | DHRS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408602 | Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 1 (DHRS1), transcript variant 2 |
CNY 3080.00 |
|
| LY427794 | Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 1 (DHRS1), transcript variant 1 |
CNY 3080.00 |
|
| PH304206 | DHRS1 MS Standard C13 and N15-labeled recombinant protein (NP_612461) |
CNY 19520.00 |
|
| TP304206 | Recombinant protein of human dehydrogenase/reductase (SDR family) member 1 (DHRS1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP327656 | Recombinant protein of human dehydrogenase/reductase (SDR family) member 1 (DHRS1), transcript variant 1, 20 µg |
CNY 2900.00 |
