alpha smooth muscle Actin (ACTA2) (NM_001141945) Human Mass Spec Standard
CAT#: PH327802
ACTA2 MS Standard C13 and N15-labeled recombinant protein (NP_001135417)
View other "alpha smooth muscle Actin" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ACTA2 MS Standard C13 and N15-labeled recombinant protein (NP_001135417) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC227802 |
| Predicted MW | 42 kDa |
| Protein Sequence |
>RC227802 protein sequence
Red=Cloning site Green=Tags(s) MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLK YPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQA VLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREI VRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETT YNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILAS LSTFQQMWISKQEYDEAGPSIVHRKCF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001135417 |
| RefSeq Size | 1798 |
| RefSeq ORF | 1131 |
| Synonyms | ACTSA |
| Locus ID | 59 |
| Cytogenetics | 10q23.31 |
| Summary | This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, integrity, and intercellular signaling. The encoded protein is a smooth muscle actin that is involved in vascular contractility and blood pressure homeostasis. Mutations in this gene cause a variety of vascular diseases, such as thoracic aortic disease, coronary artery disease, stroke, and Moyamoya disease, as well as multisystemic smooth muscle dysfunction syndrome. [provided by RefSeq, Sep 2017] |
| Protein Pathways | Vascular smooth muscle contraction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400608 | ACTA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427983 | ACTA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400608 | Transient overexpression lysate of actin, alpha 2, smooth muscle, aorta (ACTA2), transcript variant 2 |
CNY 3080.00 |
|
| LY427983 | Transient overexpression lysate of actin, alpha 2, smooth muscle, aorta (ACTA2), transcript variant 1 |
CNY 3080.00 |
|
| TP327802 | Recombinant protein of human actin, alpha 2, smooth muscle, aorta (ACTA2), transcript variant 1, 20 µg |
CNY 2900.00 |
其它alpha smooth muscle Actin产品
