CDK6 (NM_001145306) Human Mass Spec Standard
CAT#: PH327978
CDK6 MS Standard C13 and N15-labeled recombinant protein (NP_001138778)
View other "CDK6" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | CDK6 MS Standard C13 and N15-labeled recombinant protein (NP_001138778) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC227978 |
| Predicted MW | 36.9 kDa |
| Protein Sequence |
>RC227978 protein sequence
Red=Cloning site Green=Tags(s) MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLET FEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHR VVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFA EMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKC LTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001138778 |
| RefSeq Size | 11733 |
| RefSeq ORF | 978 |
| Synonyms | MCPH12; PLSTIRE |
| Locus ID | 1021 |
| Cytogenetics | 7q21.2 |
| Summary | The protein encoded by this gene is a member of the CMGC family of serine/threonine protein kinases. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity of this kinase first appears in mid-G1 phase, which is controlled by the regulatory subunits including D-type cyclins and members of INK4 family of CDK inhibitors. This kinase, as well as CDK4, has been shown to phosphorylate, and thus regulate the activity of, tumor suppressor protein Rb. Altered expression of this gene has been observed in multiple human cancers. A mutation in this gene resulting in reduced cell proliferation, and impaired cell motility and polarity, and has been identified in patients with primary microcephaly. [provided by RefSeq, Aug 2017] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Cell cycle, Chronic myeloid leukemia, Glioma, Melanoma, Non-small cell lung cancer, p53 signaling pathway, Pancreatic cancer, Pathways in cancer, Small cell lung cancer |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400506 | CDK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428809 | CDK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400506 | Transient overexpression lysate of cyclin-dependent kinase 6 (CDK6), transcript variant 1 |
CNY 3080.00 |
|
| LY428809 | Transient overexpression lysate of cyclin-dependent kinase 6 (CDK6), transcript variant 2 |
CNY 3080.00 |
|
| PH308560 | CDK6 MS Standard C13 and N15-labeled recombinant protein (NP_001250) |
CNY 19520.00 |
|
| TP308560 | Recombinant protein of human cyclin-dependent kinase 6 (CDK6), 20 µg |
CNY 2900.00 |
|
| TP327978 | Purified recombinant protein of Homo sapiens cyclin-dependent kinase 6 (CDK6), 20 µg |
CNY 2900.00 |
