GAL4 (LGALS4) (NM_006149) Human Recombinant Protein
CAT#: TP300026
Recombinant protein of human lectin, galactoside-binding, soluble, 4 (LGALS4), 20 µg
View other "GAL4" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200026 representing NM_006149
Red=Cloning site Green=Tags(s) MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDG WDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDG DLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIII KGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRC GLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI TRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 35.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006140 |
Locus ID | 3960 |
UniProt ID | P56470 |
Refseq Size | 1117 |
Cytogenetics | 19q13.2 |
Refseq ORF | 969 |
Synonyms | GAL4; L36LBP |
Summary | The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The expression of this gene is restricted to small intestine, colon, and rectum, and it is underexpressed in colorectal cancer. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416836 | LGALS4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416836 | Transient overexpression lysate of lectin, galactoside-binding, soluble, 4 (LGALS4) |
CNY 3080.00 |
|
PH300026 | LGALS4 MS Standard C13 and N15-labeled recombinant protein (NP_006140) |
CNY 19520.00 |