PSMD13 (NM_002817) Human Recombinant Protein
CAT#: TP300037
Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 13 (PSMD13), transcript variant 1, 20 µg
View other "PSMD13" proteins (5)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC200037 protein sequence 
Red=Cloning site Green=Tags(s) MKDVPGFLQQSQSSGPGQPAVWHRLEELYTKKLWHQLTLQVLDFVQDPCFAQGDGLIKLYENFISEFEHR VNPLSLVEIILHVVRQMTDPNVALTFLEKTREKVKSSDEAVILCKTAIGALKLNIGDLQVTKETIEDVEE MLNNLPGVTSVHSRFYDLSSKYYQTIGNHASYYKDALRFLGCVDIKDLPVSEQQERAFTLGLAGLLGEGV FNFGELLMHPVLESLRNTDRQWLIDTLYAFNSGNVERFQTLKTAWGQQPDLAANEAQLLRKIQLLCLMEM TFTRPANHRQLTFEEIAKSAKITVNEVELLVMKALSVGLVKGSIDEVDKRVHMTWVQPRVLDLQQIKGMK DRLEFWCTDVKSMEMLVEHQAHDILT SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 42.8 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_002808 | 
| Locus ID | 5719 | 
| UniProt ID | Q9UNM6 | 
| Refseq Size | 1757 | 
| Cytogenetics | 11p15.5 | 
| Refseq ORF | 1128 | 
| Synonyms | HSPC027; p40.5; Rpn9; S11 | 
| Summary | The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. Two transcripts encoding different isoforms have been described. [provided by RefSeq, Jul 2008] | 
| Protein Pathways | Proteasome | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC400998 | PSMD13 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC406216 | PSMD13 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY400998 | Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, non-ATPase, 13 (PSMD13), transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| LY406216 | Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, non-ATPase, 13 (PSMD13), transcript variant 2 | 
                                                     CNY 3080.00  | 
                                            |
| PH300037 | PSMD13 MS Standard C13 and N15-labeled recombinant protein (NP_002808) | 
                                                     CNY 19520.00  | 
                                            
