GIT2 (NM_139201) Human Recombinant Protein
CAT#: TP300045
Recombinant protein of human G protein-coupled receptor kinase interacting ArfGAP 2 (GIT2), transcript variant 4, 20 µg
View other "GIT2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200045 protein sequence
Red=Cloning site Green=Tags(s) MSKRLRSSEVCADCSGPDPSWASVNRGTFLCDECCSVHRSLGRHISQVRHLKHTPWPPTLLQMVETLYNN GANSIWEHSLLDPASIMSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRLPCRDDDSVTAKDLSKQLHSS VRTGNLETCLRLLSLGAQANFFHPEKGNTPLHVASKAGQILQAELLAVYGADPGTQDSSGKTPVDYARQG GHHELAERLVEIQYELTDRLAFYLCGRKPDHKNGQHFIIPQMADSSLDLSELAKAAKKKLQSLSNHLFEE LAMDMYDEVDRRETDAVWLATQNHSALVTETTVVPFLPVNPEYSSTRNQGRQKLARFNAHEFATLVIDIL SDAKRRQQGSSLSGSKDNVELILKTINNQHSVESQDNDQPDYDSVASDEDTDLETTASKTNRQKSLDSDL SDGPVTVQEFMEVKNALVASEAKIQQLMKVNNNLSDELRIMQKKLLGKDAN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 52.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_631940 |
| Locus ID | 9815 |
| UniProt ID | Q6FI58 |
| Refseq Size | 2357 |
| Cytogenetics | 12q24.11 |
| Refseq ORF | 1413 |
| Synonyms | CAT-2; CAT2; PKL |
| Summary | This gene encodes a member of the GIT protein family, which interact with G protein-coupled receptor kinases and possess ADP-ribosylation factor (ARF) GTPase-activating protein (GAP) activity. GIT proteins traffic between cytoplasmic complexes, focal adhesions, and the cell periphery, and interact with Pak interacting exchange factor beta (PIX) to form large oligomeric complexes that transiently recruit other proteins. GIT proteins regulate cytoskeletal dynamics and participate in receptor internalization and membrane trafficking. This gene has been shown to repress lamellipodial extension and focal adhesion turnover, and is thought to regulate cell motility. This gene undergoes extensive alternative splicing to generate multiple isoforms, but the full-length nature of some of these variants has not been determined. The various isoforms have functional differences, with respect to ARF GAP activity and to G protein-coupled receptor kinase 2 binding. [provided by RefSeq, Sep 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Endocytosis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408350 | GIT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415041 | GIT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC427594 | GIT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY408350 | Transient overexpression lysate of G protein-coupled receptor kinase interacting ArfGAP 2 (GIT2), transcript variant 4 |
CNY 3080.00 |
|
| LY415041 | Transient overexpression lysate of G protein-coupled receptor kinase interacting ArfGAP 2 (GIT2), transcript variant 3 |
CNY 4840.00 |
|
| LY427594 | Transient overexpression lysate of G protein-coupled receptor kinase interacting ArfGAP 2 (GIT2), transcript variant 6 |
CNY 4840.00 |
|
| PH300045 | GIT2 MS Standard C13 and N15-labeled recombinant protein (NP_631940) |
CNY 19520.00 |
