TMEM208 (NM_014187) Human Recombinant Protein
CAT#: TP300049
Recombinant protein of human transmembrane protein 208 (TMEM208), 20 µg
View other "TMEM208" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200049 protein sequence
Red=Cloning site Green=Tags(s) MAPKGKVGTRGKKQIFEENRETLKFYLRIILGANAIYCLVTLVFFYSSASFWAWLALGFSLAVYGASYHS MSSMARAAFSEDGALMDGGMDLNMEQGMAEHLKDVILLTAIVQVLSCFSLYVWSFWLLAPGRALYLLWVN VLGPWFTADSGTPAPEHNEKRQRRQERRQMKRL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_054906 |
Locus ID | 29100 |
UniProt ID | Q9BTX3 |
Refseq Size | 808 |
Cytogenetics | 16q22.1 |
Refseq ORF | 519 |
Synonyms | hSND2; HSPC171 |
Summary | This gene encodes a highly conserved protein which is localized in the endoplasmic reticulum (ER). The protein is linked to autophagy and ER stress. Knockdown of this gene increased autophagy and triggered ER stress. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415449 | TMEM208 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415449 | Transient overexpression lysate of transmembrane protein 208 (TMEM208) |
CNY 3080.00 |
|
PH300049 | TMEM208 MS Standard C13 and N15-labeled recombinant protein (NP_054906) |
CNY 19520.00 |
其它TMEM208产品