METTL11A (NTMT1) (NM_014064) Human Recombinant Protein
CAT#: TP300055
Recombinant protein of human methyltransferase like 11A (METTL11A), 20 µg
View other "METTL11A" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200055 protein sequence
Red=Cloning site Green=Tags(s) MTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKTGTSCALDCGA GIGRITKRLLLPLFREVDMVDITEDFLVQAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGH LTDQHLAEFLRRCKGSLRPNGIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENL PDEIYHVYSFALR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 25.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_054783 |
| Locus ID | 28989 |
| UniProt ID | Q9BV86 |
| Refseq Size | 1536 |
| Cytogenetics | 9q34.11 |
| Refseq ORF | 669 |
| Synonyms | AD-003; C9orf32; HOMT1A; METTL11A; NRMT; NRMT1; NTM1A |
| Summary | The METTL11A gene encodes an N-terminal methyltransferase for the RAN (MIM 601179) guanine nucleotide exchange factor regulator of chromosome condensation 1 (RCC1; MIM 179710). METTL11A enzyme alpha-N-methylates other protein targets such as SET (MIM 600960) and RB (MIM 180200).[supplied by OMIM, Nov 2010] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415489 | NTMT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415489 | Transient overexpression lysate of methyltransferase like 11A (METTL11A) |
CNY 3080.00 |
|
| PH300055 | METTL11A MS Standard C13 and N15-labeled recombinant protein (NP_054783) |
CNY 19520.00 |
其它METTL11A产品
