Bif (SH3GLB1) (NM_016009) Human Recombinant Protein
CAT#: TP300106
Recombinant protein of human SH3-domain GRB2-like endophilin B1 (SH3GLB1), 20 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200106 protein sequence
Red=Cloning site Green=Tags(s) MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPN PNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSA LNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETRNSSEQELRITQSEFDRQAEITR LLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSNYLSNNNQTSVTPVPSVLPNAIG SSAMASTSGLVITSPSNLSDLKECSGSRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERG NQKGKVPITYLELLN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 40.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057093 |
| Locus ID | 51100 |
| UniProt ID | Q9Y371 |
| Refseq Size | 6382 |
| Cytogenetics | 1p22.3 |
| Refseq ORF | 1095 |
| Synonyms | Bif-1; CGI-61; dJ612B15.2; PPP1R70 |
| Summary | This gene encodes a SRC homology 3 domain-containing protein. The encoded protein interacts with the proapoptotic member of the Bcl-2 family, Bcl-2-associated X protein (Bax) and may be involved in regulating apoptotic signaling pathways. This protein may also be involved in maintaining mitochondrial morphology. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011] |
| Protein Pathways | Endocytosis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414250 | SH3GLB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414250 | Transient overexpression lysate of SH3-domain GRB2-like endophilin B1 (SH3GLB1) |
CNY 3080.00 |
|
| PH300106 | SH3GLB1 MS Standard C13 and N15-labeled recombinant protein (NP_057093) |
CNY 19520.00 |
