RAI3 (GPRC5A) (NM_003979) Human Recombinant Protein
CAT#: TP300118
Recombinant protein of human G protein-coupled receptor, family C, group 5, member A (GPRC5A), 20 µg
View other "RAI3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200118 protein sequence
Red=Cloning site Green=Tags(s) MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSNRRKMLPTQFL FLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVG FSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHG AHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVE DAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY EVKKEGS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003970 |
Locus ID | 9052 |
UniProt ID | Q8NFJ5 |
Refseq Size | 2856 |
Cytogenetics | 12p13.1 |
Refseq ORF | 1071 |
Synonyms | GPCR5A; PEIG-1; RAI3; RAIG1; TIG1 |
Summary | This gene encodes a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The encoded protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. This gene may play a role in embryonic development and epithelial cell differentiation. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401304 | GPRC5A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401304 | Transient overexpression lysate of G protein-coupled receptor, family C, group 5, member A (GPRC5A) |
CNY 3080.00 |
|
PH300118 | GPRC5A MS Standard C13 and N15-labeled recombinant protein (NP_003970) |
CNY 19520.00 |